Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136JEJ9

Protein Details
Accession A0A136JEJ9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MVSRPHARRRSGQRLPRARKEKTACQRRRNLGSRRBasic
NLS Segment(s)
PositionSequence
5-45PHARRRSGQRLPRARKEKTACQRRRNLGSRRAKQQSQRPKR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MVSRPHARRRSGQRLPRARKEKTACQRRRNLGSRRAKQQSQRPKRLMVVQKATPPQPRSPMEAQRRAWPLHQHQTSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.87
4 0.85
5 0.78
6 0.78
7 0.76
8 0.76
9 0.76
10 0.78
11 0.77
12 0.78
13 0.83
14 0.81
15 0.83
16 0.82
17 0.79
18 0.78
19 0.79
20 0.76
21 0.76
22 0.74
23 0.69
24 0.67
25 0.68
26 0.69
27 0.69
28 0.72
29 0.66
30 0.63
31 0.61
32 0.63
33 0.62
34 0.58
35 0.54
36 0.48
37 0.51
38 0.51
39 0.53
40 0.51
41 0.47
42 0.43
43 0.45
44 0.44
45 0.45
46 0.48
47 0.54
48 0.56
49 0.61
50 0.59
51 0.6
52 0.62
53 0.58
54 0.56
55 0.56
56 0.55
57 0.57
58 0.58