Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WHS0

Protein Details
Accession G0WHS0    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
142-165TANAANKKSEQKGKKNKNKNKKKRBasic
NLS Segment(s)
PositionSequence
98-98K
101-109VPKNSSKKK
148-165KKSEQKGKKNKNKNKKKR
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG ndi:NDAI_0K01400  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVKPIDTFITSSVKLFEVNPSQTTFTISYRGPSDTDNNKKKTSVSFRSHNAHLGVSYKFNTNKSKDVSRLLNAIGPRGVSITPGKIEKNKMIINGKKIVVPKNSSKKKKLIQDIVGLGSLITNSDVKEYIPPVHTTNENTTANAANKKSEQKGKKNKNKNKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.22
5 0.23
6 0.25
7 0.27
8 0.27
9 0.29
10 0.28
11 0.31
12 0.27
13 0.21
14 0.22
15 0.21
16 0.21
17 0.21
18 0.22
19 0.19
20 0.2
21 0.26
22 0.32
23 0.43
24 0.49
25 0.51
26 0.51
27 0.52
28 0.51
29 0.52
30 0.52
31 0.51
32 0.5
33 0.51
34 0.56
35 0.6
36 0.59
37 0.54
38 0.45
39 0.35
40 0.29
41 0.26
42 0.2
43 0.17
44 0.17
45 0.17
46 0.19
47 0.22
48 0.28
49 0.29
50 0.33
51 0.35
52 0.38
53 0.37
54 0.4
55 0.39
56 0.34
57 0.33
58 0.28
59 0.26
60 0.22
61 0.2
62 0.15
63 0.11
64 0.1
65 0.09
66 0.08
67 0.07
68 0.08
69 0.08
70 0.09
71 0.11
72 0.12
73 0.14
74 0.16
75 0.17
76 0.22
77 0.22
78 0.25
79 0.32
80 0.34
81 0.35
82 0.37
83 0.35
84 0.33
85 0.35
86 0.35
87 0.32
88 0.34
89 0.38
90 0.45
91 0.54
92 0.59
93 0.61
94 0.65
95 0.67
96 0.71
97 0.72
98 0.7
99 0.64
100 0.63
101 0.6
102 0.53
103 0.46
104 0.36
105 0.26
106 0.18
107 0.13
108 0.07
109 0.06
110 0.05
111 0.05
112 0.07
113 0.07
114 0.08
115 0.1
116 0.12
117 0.15
118 0.17
119 0.19
120 0.2
121 0.23
122 0.25
123 0.27
124 0.3
125 0.34
126 0.32
127 0.31
128 0.3
129 0.31
130 0.33
131 0.35
132 0.31
133 0.28
134 0.32
135 0.38
136 0.44
137 0.5
138 0.55
139 0.61
140 0.71
141 0.78
142 0.84
143 0.89
144 0.92
145 0.93