Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZQ96

Protein Details
Accession E4ZQ96    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
135-157GKDNNSKKKGSPENKDKPKLDNRBasic
NLS Segment(s)
PositionSequence
142-151KKGSPENKDK
Subcellular Location(s) mito 13, plas 5, golg 5, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023616  Cyt_c_oxase-like_su1_dom  
IPR036927  Cyt_c_oxase-like_su1_sf  
IPR000883  Cyt_C_Oxase_1  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0004129  F:cytochrome-c oxidase activity  
GO:0020037  F:heme binding  
GO:0009060  P:aerobic respiration  
Pfam View protein in Pfam  
PF00115  COX1  
PROSITE View protein in PROSITE  
PS50855  COX1  
Amino Acid Sequences MIFFMVMPALIGGFGNFLLPLGLGGPDMGFPRLNNISYLMLIPSIVLFLFAGAIENGVGTGGPSVDLAIFGLHLSGISSLLGAMNLGLNVFLTYLRHSTSFQLTVNKCYFSSNKPKYMFKNNSEKDNNYGEDNNGKDNNSKKKGSPENKDKPKLDNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.04
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.08
17 0.08
18 0.14
19 0.16
20 0.17
21 0.17
22 0.18
23 0.18
24 0.17
25 0.18
26 0.13
27 0.1
28 0.09
29 0.08
30 0.06
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.02
47 0.03
48 0.02
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.03
79 0.04
80 0.05
81 0.06
82 0.07
83 0.08
84 0.09
85 0.12
86 0.15
87 0.16
88 0.17
89 0.24
90 0.24
91 0.29
92 0.3
93 0.29
94 0.26
95 0.27
96 0.28
97 0.27
98 0.37
99 0.38
100 0.45
101 0.47
102 0.53
103 0.56
104 0.64
105 0.66
106 0.62
107 0.67
108 0.62
109 0.67
110 0.67
111 0.63
112 0.57
113 0.54
114 0.48
115 0.41
116 0.39
117 0.32
118 0.32
119 0.31
120 0.32
121 0.28
122 0.28
123 0.29
124 0.36
125 0.44
126 0.45
127 0.47
128 0.46
129 0.54
130 0.64
131 0.69
132 0.72
133 0.73
134 0.77
135 0.85
136 0.9
137 0.83