Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136JJZ9

Protein Details
Accession A0A136JJZ9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKIPWRLSRFQKARQRQRLRAVDAHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-95KEKRYRKGIHKL
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNSLSGGLLWKIPWRLSRFQKARQRQRLRAVDAVVDTLDKALKRQGETLKALETWKAEMPTEAEMLPRDKYTMFDRKEKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.17
5 0.18
6 0.2
7 0.24
8 0.27
9 0.35
10 0.43
11 0.53
12 0.56
13 0.64
14 0.71
15 0.76
16 0.82
17 0.84
18 0.86
19 0.83
20 0.86
21 0.84
22 0.79
23 0.72
24 0.62
25 0.53
26 0.43
27 0.35
28 0.25
29 0.17
30 0.12
31 0.08
32 0.08
33 0.06
34 0.06
35 0.09
36 0.11
37 0.12
38 0.17
39 0.2
40 0.23
41 0.25
42 0.26
43 0.24
44 0.23
45 0.22
46 0.19
47 0.16
48 0.13
49 0.13
50 0.13
51 0.12
52 0.11
53 0.12
54 0.12
55 0.13
56 0.11
57 0.1
58 0.1
59 0.12
60 0.13
61 0.11
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.63
72 0.69
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79