Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136JGZ5

Protein Details
Accession A0A136JGZ5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-95LKAVPKSKTSHMKKRHRQMAGKAHydrophilic
NLS Segment(s)
PositionSequence
84-88MKKRH
Subcellular Location(s) mito 23, cyto_mito 14.333, mito_nucl 12.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAALQPLRAASAFTTMFARLAMPTRFGSSFQTSLSALTSVQGRLPVFPSLAIAIPAAIQTIPSILGDIWEGILKAVPKSKTSHMKKRHRQMAGKALKDVTNLNKCPACGGVKKMHTLCPTCVSRIQTELGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.14
5 0.14
6 0.1
7 0.15
8 0.15
9 0.16
10 0.17
11 0.2
12 0.21
13 0.21
14 0.25
15 0.24
16 0.25
17 0.22
18 0.23
19 0.2
20 0.19
21 0.19
22 0.14
23 0.1
24 0.09
25 0.1
26 0.09
27 0.09
28 0.12
29 0.11
30 0.11
31 0.13
32 0.13
33 0.12
34 0.11
35 0.11
36 0.09
37 0.09
38 0.09
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.03
47 0.03
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.11
63 0.11
64 0.13
65 0.16
66 0.23
67 0.33
68 0.41
69 0.5
70 0.56
71 0.67
72 0.74
73 0.82
74 0.84
75 0.82
76 0.81
77 0.79
78 0.79
79 0.77
80 0.69
81 0.61
82 0.54
83 0.46
84 0.41
85 0.36
86 0.34
87 0.34
88 0.33
89 0.35
90 0.35
91 0.34
92 0.34
93 0.33
94 0.3
95 0.25
96 0.29
97 0.34
98 0.35
99 0.43
100 0.43
101 0.47
102 0.48
103 0.48
104 0.46
105 0.46
106 0.45
107 0.42
108 0.45
109 0.42
110 0.39
111 0.38
112 0.38