Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136JBQ7

Protein Details
Accession A0A136JBQ7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-65KKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTQRALKEGKDGAAKKE
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTQRALKEGKDGAAKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.84
9 0.82
10 0.81
11 0.83
12 0.83
13 0.81
14 0.79
15 0.77
16 0.73
17 0.7
18 0.66
19 0.6
20 0.55
21 0.52
22 0.53
23 0.48
24 0.5
25 0.54
26 0.58
27 0.62
28 0.63
29 0.69
30 0.63
31 0.68
32 0.65
33 0.66
34 0.67
35 0.66
36 0.63
37 0.58
38 0.55
39 0.49
40 0.46
41 0.37
42 0.32
43 0.27
44 0.28
45 0.32