Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136IVK9

Protein Details
Accession A0A136IVK9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-70VAQSRTQQTKRWQRSRRRLALAQDVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAVWRSRRTQNQDSKNTTLVLTDRTGPVSSSGLQVIVAVKHRPSVAQSRTQQTKRWQRSRRRLALAQDVAAVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.68
3 0.6
4 0.49
5 0.41
6 0.32
7 0.25
8 0.19
9 0.17
10 0.15
11 0.16
12 0.16
13 0.14
14 0.14
15 0.13
16 0.12
17 0.12
18 0.11
19 0.09
20 0.09
21 0.09
22 0.08
23 0.07
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.12
31 0.2
32 0.22
33 0.3
34 0.34
35 0.41
36 0.5
37 0.52
38 0.56
39 0.57
40 0.65
41 0.67
42 0.73
43 0.75
44 0.77
45 0.86
46 0.91
47 0.9
48 0.88
49 0.84
50 0.8
51 0.82
52 0.74
53 0.64