Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136IKF8

Protein Details
Accession A0A136IKF8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-57EQILKQRKEWTSKNRKANFTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008949  Isoprenoid_synthase_dom_sf  
Pfam View protein in Pfam  
PF19086  Terpene_syn_C_2  
Amino Acid Sequences MEDPLVIPDLFSSIMCIEPAINRNYAGVKKEADAWIEQILKQRKEWTSKNRKANFTFLASLWAADVDEEALKVRVDYNNWVICSTYIFLFDDQFDEGHLSTRHEAAYEEIQATLSLMDDGECTDISSHENPIRFIFQDTWRRFKKVSSFNFIRSKRASTGLQQRWRAAHRHYFDGILAQVRMTEHPELSPRTIDDYMVVRRRTVGASPILPLIEYAHNIQLPTQYFKLEFVQACMNVSFDLTCYGNDVLSYKKDLSTGCEHNLLIFLQRQGFFPQEALKIIEGQLNECYKRWFIAQAEIPIVGREESLEQEKFLHACKMAPLGQLHWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.14
6 0.19
7 0.2
8 0.21
9 0.2
10 0.22
11 0.27
12 0.3
13 0.28
14 0.27
15 0.26
16 0.26
17 0.31
18 0.32
19 0.29
20 0.26
21 0.25
22 0.27
23 0.27
24 0.27
25 0.3
26 0.37
27 0.36
28 0.37
29 0.43
30 0.44
31 0.51
32 0.59
33 0.61
34 0.64
35 0.72
36 0.8
37 0.8
38 0.82
39 0.78
40 0.76
41 0.7
42 0.63
43 0.57
44 0.46
45 0.43
46 0.34
47 0.3
48 0.22
49 0.18
50 0.12
51 0.09
52 0.09
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.07
60 0.1
61 0.11
62 0.13
63 0.18
64 0.23
65 0.26
66 0.27
67 0.27
68 0.25
69 0.23
70 0.23
71 0.19
72 0.13
73 0.11
74 0.11
75 0.11
76 0.12
77 0.12
78 0.11
79 0.11
80 0.1
81 0.09
82 0.09
83 0.09
84 0.11
85 0.12
86 0.13
87 0.13
88 0.14
89 0.14
90 0.13
91 0.13
92 0.12
93 0.14
94 0.13
95 0.13
96 0.12
97 0.12
98 0.11
99 0.11
100 0.08
101 0.06
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.08
113 0.09
114 0.12
115 0.14
116 0.15
117 0.15
118 0.17
119 0.18
120 0.16
121 0.17
122 0.17
123 0.22
124 0.31
125 0.33
126 0.4
127 0.41
128 0.43
129 0.42
130 0.42
131 0.44
132 0.43
133 0.46
134 0.47
135 0.48
136 0.52
137 0.61
138 0.58
139 0.54
140 0.46
141 0.43
142 0.36
143 0.37
144 0.31
145 0.29
146 0.38
147 0.42
148 0.47
149 0.46
150 0.46
151 0.45
152 0.46
153 0.43
154 0.36
155 0.36
156 0.31
157 0.33
158 0.32
159 0.3
160 0.27
161 0.25
162 0.21
163 0.14
164 0.12
165 0.08
166 0.08
167 0.07
168 0.08
169 0.09
170 0.1
171 0.09
172 0.1
173 0.13
174 0.14
175 0.15
176 0.15
177 0.13
178 0.16
179 0.16
180 0.15
181 0.14
182 0.16
183 0.21
184 0.26
185 0.26
186 0.22
187 0.22
188 0.24
189 0.23
190 0.21
191 0.19
192 0.16
193 0.16
194 0.17
195 0.17
196 0.16
197 0.14
198 0.13
199 0.12
200 0.1
201 0.1
202 0.1
203 0.12
204 0.13
205 0.13
206 0.13
207 0.15
208 0.16
209 0.18
210 0.18
211 0.17
212 0.16
213 0.18
214 0.2
215 0.21
216 0.19
217 0.18
218 0.21
219 0.2
220 0.21
221 0.19
222 0.17
223 0.12
224 0.12
225 0.1
226 0.07
227 0.09
228 0.08
229 0.08
230 0.1
231 0.1
232 0.1
233 0.1
234 0.11
235 0.11
236 0.13
237 0.16
238 0.14
239 0.15
240 0.17
241 0.17
242 0.22
243 0.26
244 0.29
245 0.28
246 0.31
247 0.3
248 0.28
249 0.29
250 0.23
251 0.19
252 0.17
253 0.16
254 0.17
255 0.18
256 0.2
257 0.21
258 0.23
259 0.21
260 0.2
261 0.22
262 0.19
263 0.2
264 0.21
265 0.19
266 0.18
267 0.18
268 0.2
269 0.16
270 0.16
271 0.2
272 0.22
273 0.23
274 0.23
275 0.25
276 0.23
277 0.25
278 0.25
279 0.25
280 0.23
281 0.3
282 0.35
283 0.35
284 0.36
285 0.36
286 0.34
287 0.28
288 0.27
289 0.19
290 0.13
291 0.1
292 0.1
293 0.13
294 0.19
295 0.19
296 0.18
297 0.2
298 0.22
299 0.22
300 0.23
301 0.24
302 0.19
303 0.2
304 0.22
305 0.26
306 0.27
307 0.3
308 0.3