Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136JJ56

Protein Details
Accession A0A136JJ56    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPSATGGKKQKKKWSKGKVKDKAQHAVMHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSATGGKKQKKKWSKGKVKDKAQHAVMLDKTTSEKLYKDVQSYRLVTVATLVDRMKINGSLARRCLKDLEEKGQIKPVVTHSKMKIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.4
16 0.35
17 0.28
18 0.2
19 0.2
20 0.17
21 0.17
22 0.13
23 0.12
24 0.13
25 0.2
26 0.22
27 0.24
28 0.26
29 0.28
30 0.31
31 0.32
32 0.3
33 0.24
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.17
50 0.21
51 0.26
52 0.26
53 0.26
54 0.27
55 0.27
56 0.33
57 0.34
58 0.37
59 0.41
60 0.42
61 0.42
62 0.47
63 0.45
64 0.36
65 0.34
66 0.36
67 0.36
68 0.38
69 0.44
70 0.4
71 0.48
72 0.52
73 0.53
74 0.53
75 0.48
76 0.5
77 0.46