Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136JAV1

Protein Details
Accession A0A136JAV1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MKKLLKPKKDKATKTKEKKKKEEVPKGTKETDBasic
NLS Segment(s)
PositionSequence
3-26KLLKPKKDKATKTKEKKKKEEVPK
Subcellular Location(s) nucl 19.5, mito_nucl 13.333, cyto_nucl 11.666, mito 5
Family & Domain DBs
Amino Acid Sequences MKKLLKPKKDKATKTKEKKKKEEVPKGTKETDNSQENTNHQRSFGHPAALYDPNWLMPPQSNVIHVEHSMEAPSDPRPNAFFDNRNGVMRVYHGSSFGNPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.92
5 0.92
6 0.92
7 0.91
8 0.91
9 0.91
10 0.9
11 0.9
12 0.88
13 0.84
14 0.77
15 0.69
16 0.61
17 0.56
18 0.53
19 0.47
20 0.4
21 0.37
22 0.36
23 0.37
24 0.41
25 0.4
26 0.32
27 0.28
28 0.27
29 0.26
30 0.32
31 0.29
32 0.24
33 0.2
34 0.21
35 0.24
36 0.25
37 0.22
38 0.16
39 0.14
40 0.12
41 0.13
42 0.12
43 0.09
44 0.08
45 0.1
46 0.12
47 0.13
48 0.13
49 0.15
50 0.16
51 0.17
52 0.16
53 0.16
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.09
60 0.11
61 0.14
62 0.13
63 0.15
64 0.16
65 0.2
66 0.25
67 0.29
68 0.31
69 0.31
70 0.39
71 0.4
72 0.41
73 0.38
74 0.33
75 0.28
76 0.27
77 0.26
78 0.21
79 0.19
80 0.19
81 0.19