Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136JCI7

Protein Details
Accession A0A136JCI7   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-119GCCTWWCWLPRRDKRRDRAKQERRDARQLAAHydrophilic
NLS Segment(s)
PositionSequence
99-112RRDKRRDRAKQERR
Subcellular Location(s) nucl 7.5cyto_nucl 7.5, cyto 6.5, plas 5, mito 4, extr 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDYDFVTMHKPWFIHWALSDASSMTLAPPALGACVTLQLPTWVPGDAVSTLLAQAPPCGNDIQKPWYKNEYILIPVIALPLSIAGLAGCCTWWCWLPRRDKRRDRAKQERRDARQLAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.24
5 0.22
6 0.22
7 0.22
8 0.15
9 0.14
10 0.11
11 0.1
12 0.07
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.04
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.08
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.07
40 0.07
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.07
48 0.09
49 0.12
50 0.17
51 0.21
52 0.22
53 0.24
54 0.27
55 0.27
56 0.27
57 0.27
58 0.22
59 0.2
60 0.19
61 0.16
62 0.13
63 0.12
64 0.11
65 0.08
66 0.06
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.02
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.07
80 0.1
81 0.13
82 0.21
83 0.28
84 0.39
85 0.5
86 0.59
87 0.69
88 0.76
89 0.83
90 0.86
91 0.9
92 0.9
93 0.91
94 0.92
95 0.92
96 0.93
97 0.93
98 0.9
99 0.89
100 0.81