Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZV16

Protein Details
Accession E4ZV16    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-74RTKQNREQAKEKREKIKQVWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 5, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPHLHTEEVQKSCAEVVAALDECHARGFLWKVAGNCTDAKYKVNMCLRGLRLERTKQNREQAKEKREKIKQVWAELDANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.17
3 0.09
4 0.08
5 0.1
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.09
13 0.06
14 0.08
15 0.1
16 0.11
17 0.14
18 0.16
19 0.17
20 0.19
21 0.2
22 0.2
23 0.18
24 0.19
25 0.18
26 0.16
27 0.17
28 0.16
29 0.17
30 0.22
31 0.26
32 0.27
33 0.25
34 0.31
35 0.31
36 0.36
37 0.36
38 0.35
39 0.36
40 0.39
41 0.47
42 0.49
43 0.55
44 0.55
45 0.63
46 0.66
47 0.66
48 0.7
49 0.71
50 0.73
51 0.76
52 0.77
53 0.78
54 0.78
55 0.81
56 0.77
57 0.78
58 0.74
59 0.71
60 0.67
61 0.61