Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136JJB4

Protein Details
Accession A0A136JJB4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-77RSRLYCCAQARRRCRCRCRCRCRCRCRCRCLFDRVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, plas 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MERARQCTFCLLLFRGSGCPGYATSFCSRTALAHPWVWMKTRSRLYCCAQARRRCRCRCRCRCRCRCRCRCLFDRVGMHCSKVAWRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.22
4 0.2
5 0.15
6 0.14
7 0.12
8 0.15
9 0.14
10 0.16
11 0.18
12 0.19
13 0.19
14 0.19
15 0.19
16 0.17
17 0.2
18 0.2
19 0.2
20 0.2
21 0.21
22 0.22
23 0.23
24 0.23
25 0.23
26 0.22
27 0.26
28 0.33
29 0.35
30 0.36
31 0.4
32 0.42
33 0.47
34 0.5
35 0.52
36 0.53
37 0.58
38 0.64
39 0.7
40 0.77
41 0.77
42 0.83
43 0.84
44 0.88
45 0.9
46 0.92
47 0.92
48 0.94
49 0.95
50 0.96
51 0.96
52 0.95
53 0.95
54 0.94
55 0.93
56 0.9
57 0.86
58 0.84
59 0.8
60 0.76
61 0.74
62 0.69
63 0.65
64 0.58
65 0.52
66 0.44
67 0.38