Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R517

Protein Details
Accession E5R517    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-54ANKAAMQRRSHKRKRVQKEGTLTHydrophilic
NLS Segment(s)
PositionSequence
37-46MQRRSHKRKR
Subcellular Location(s) mito 9.5mito_nucl 9.5, cyto 9, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MVEAFEKKAKGAAVVAHKLVLAQKENAELRAANKAAMQRRSHKRKRVQKEGTLTVEKGLRLTTLKEFTARSDGIKALKRVRAELGEPTQRRCGRCDEAGHNGRTCKQEVECISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.27
4 0.26
5 0.25
6 0.26
7 0.23
8 0.18
9 0.16
10 0.17
11 0.22
12 0.23
13 0.23
14 0.22
15 0.19
16 0.18
17 0.23
18 0.22
19 0.17
20 0.18
21 0.22
22 0.28
23 0.33
24 0.35
25 0.39
26 0.49
27 0.6
28 0.66
29 0.71
30 0.74
31 0.79
32 0.85
33 0.86
34 0.84
35 0.81
36 0.79
37 0.76
38 0.71
39 0.62
40 0.52
41 0.43
42 0.36
43 0.28
44 0.21
45 0.15
46 0.1
47 0.09
48 0.1
49 0.12
50 0.13
51 0.13
52 0.15
53 0.15
54 0.16
55 0.2
56 0.18
57 0.16
58 0.16
59 0.17
60 0.2
61 0.24
62 0.27
63 0.28
64 0.31
65 0.31
66 0.31
67 0.32
68 0.3
69 0.27
70 0.3
71 0.32
72 0.37
73 0.38
74 0.4
75 0.46
76 0.48
77 0.47
78 0.43
79 0.44
80 0.41
81 0.45
82 0.48
83 0.45
84 0.51
85 0.57
86 0.58
87 0.54
88 0.5
89 0.49
90 0.46
91 0.42
92 0.37
93 0.31
94 0.36