Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZZE8

Protein Details
Accession E4ZZE8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RSAPRKAARPWGRKRTLCNAHydrophilic
NLS Segment(s)
PositionSequence
10-10R
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRSAPRKAARPWGRKRTLCNAVTDRARTCKRTKDGTMIKSRLAQPRFNSSPSRAAKTRAFQGSFAAGAGAGSPGRSTVTGNVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.78
5 0.7
6 0.67
7 0.6
8 0.57
9 0.56
10 0.53
11 0.45
12 0.44
13 0.46
14 0.42
15 0.43
16 0.46
17 0.47
18 0.51
19 0.51
20 0.53
21 0.57
22 0.6
23 0.64
24 0.57
25 0.52
26 0.49
27 0.51
28 0.48
29 0.43
30 0.39
31 0.33
32 0.4
33 0.41
34 0.4
35 0.38
36 0.34
37 0.4
38 0.39
39 0.43
40 0.35
41 0.38
42 0.4
43 0.41
44 0.45
45 0.43
46 0.41
47 0.36
48 0.37
49 0.34
50 0.29
51 0.25
52 0.17
53 0.1
54 0.08
55 0.08
56 0.07
57 0.05
58 0.05
59 0.05
60 0.05
61 0.07
62 0.08
63 0.09