Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5ADP5

Protein Details
Accession E5ADP5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-87NVVWSDICKKKRWKKERERGVGVRAQHydrophilic
NLS Segment(s)
PositionSequence
70-88KKKRWKKERERGVGVRAQR
Subcellular Location(s) mito 16, mito_nucl 14.166, nucl 10, cyto_nucl 6.666
Family & Domain DBs
Amino Acid Sequences MSPTSPKNRIVTPHTTYHPPVHSPTPPRKLTRSPPTKPHTFSKSRQRSTERKIKYQSGDMQNVVWSDICKKKRWKKERERGVGVRAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.49
4 0.49
5 0.45
6 0.4
7 0.39
8 0.37
9 0.4
10 0.43
11 0.49
12 0.52
13 0.54
14 0.55
15 0.57
16 0.59
17 0.63
18 0.66
19 0.66
20 0.63
21 0.67
22 0.69
23 0.7
24 0.66
25 0.63
26 0.6
27 0.57
28 0.58
29 0.6
30 0.64
31 0.61
32 0.64
33 0.64
34 0.65
35 0.66
36 0.69
37 0.63
38 0.61
39 0.62
40 0.62
41 0.58
42 0.56
43 0.56
44 0.54
45 0.52
46 0.45
47 0.4
48 0.35
49 0.32
50 0.27
51 0.19
52 0.12
53 0.15
54 0.22
55 0.25
56 0.32
57 0.42
58 0.52
59 0.63
60 0.72
61 0.78
62 0.81
63 0.89
64 0.93
65 0.92
66 0.92
67 0.87
68 0.84