Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5ADZ6

Protein Details
Accession E5ADZ6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-108AFLPYLRRYRYRYRYRYRYRYRYVARGLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 6, cyto 4, pero 3
Family & Domain DBs
Amino Acid Sequences MAESETWQATMAAGRRVQVDDARPTTNRWLRRGRVWLVRCVACAQPDLGPAYFRRVSLPRYLLYSTLMKTAVCTLWGEHAFLPYLRRYRYRYRYRYRYRYRYVARGLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.23
5 0.23
6 0.25
7 0.28
8 0.3
9 0.33
10 0.32
11 0.33
12 0.41
13 0.43
14 0.44
15 0.43
16 0.48
17 0.49
18 0.55
19 0.6
20 0.56
21 0.59
22 0.56
23 0.56
24 0.53
25 0.49
26 0.43
27 0.38
28 0.33
29 0.24
30 0.22
31 0.17
32 0.13
33 0.13
34 0.14
35 0.12
36 0.11
37 0.11
38 0.16
39 0.15
40 0.15
41 0.16
42 0.17
43 0.19
44 0.23
45 0.25
46 0.2
47 0.22
48 0.23
49 0.2
50 0.21
51 0.21
52 0.17
53 0.16
54 0.16
55 0.12
56 0.12
57 0.14
58 0.11
59 0.1
60 0.1
61 0.08
62 0.14
63 0.15
64 0.16
65 0.14
66 0.15
67 0.15
68 0.15
69 0.17
70 0.16
71 0.21
72 0.23
73 0.29
74 0.34
75 0.44
76 0.54
77 0.62
78 0.68
79 0.74
80 0.82
81 0.87
82 0.92
83 0.93
84 0.92
85 0.9
86 0.9
87 0.86
88 0.85
89 0.81