Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZWK7

Protein Details
Accession E4ZWK7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-109PSITRPRRPFLYKARPRSRSTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MGTVDGDDYITKPQTAQPHVLANRSTTHPTQTDVSVQWPPYSSSFSLSPPPRPMCDAAGTARCALPAPKRLPTTSLHLGLSCAFPRSPSITRPRRPFLYKARPRSRSTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.31
4 0.3
5 0.38
6 0.4
7 0.43
8 0.39
9 0.33
10 0.33
11 0.32
12 0.33
13 0.25
14 0.28
15 0.25
16 0.26
17 0.26
18 0.24
19 0.24
20 0.2
21 0.22
22 0.21
23 0.21
24 0.19
25 0.18
26 0.18
27 0.17
28 0.19
29 0.16
30 0.15
31 0.16
32 0.17
33 0.24
34 0.24
35 0.26
36 0.29
37 0.31
38 0.29
39 0.29
40 0.29
41 0.24
42 0.24
43 0.22
44 0.18
45 0.19
46 0.19
47 0.17
48 0.16
49 0.14
50 0.12
51 0.13
52 0.15
53 0.2
54 0.23
55 0.28
56 0.3
57 0.31
58 0.33
59 0.33
60 0.36
61 0.34
62 0.33
63 0.28
64 0.26
65 0.26
66 0.24
67 0.24
68 0.17
69 0.14
70 0.12
71 0.12
72 0.14
73 0.2
74 0.21
75 0.26
76 0.36
77 0.44
78 0.53
79 0.61
80 0.66
81 0.68
82 0.7
83 0.72
84 0.73
85 0.74
86 0.75
87 0.78
88 0.82
89 0.81
90 0.81