Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZU01

Protein Details
Accession E4ZU01    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-59IFKGIYPREPRNKKKVSKGSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF06732  Pescadillo_N  
Amino Acid Sequences MAGRSKKKGTSGAAKNYITRTRAVKKLQISLPDFRRLCIFKGIYPREPRNKKKVSKGSTAATTFYYTKDIQYLLHEPLLAKFREHKAVAKKIGRALGRGEAGDAQRLEKNLMPKVKLDHIIKERYPTFVDALRDLDDALSMLFLFANLPSSEHIPAKTIALCQRLTRDRSYPSRASTTRPPFKVRTSSGYKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.62
4 0.61
5 0.52
6 0.46
7 0.44
8 0.43
9 0.5
10 0.52
11 0.52
12 0.52
13 0.59
14 0.59
15 0.59
16 0.57
17 0.57
18 0.56
19 0.59
20 0.54
21 0.46
22 0.48
23 0.41
24 0.39
25 0.39
26 0.36
27 0.3
28 0.4
29 0.46
30 0.47
31 0.53
32 0.6
33 0.62
34 0.71
35 0.75
36 0.75
37 0.79
38 0.78
39 0.81
40 0.83
41 0.78
42 0.77
43 0.74
44 0.68
45 0.64
46 0.58
47 0.48
48 0.39
49 0.35
50 0.27
51 0.23
52 0.22
53 0.16
54 0.15
55 0.15
56 0.14
57 0.12
58 0.16
59 0.17
60 0.15
61 0.16
62 0.15
63 0.14
64 0.16
65 0.19
66 0.16
67 0.14
68 0.17
69 0.18
70 0.24
71 0.24
72 0.27
73 0.31
74 0.38
75 0.45
76 0.44
77 0.43
78 0.41
79 0.45
80 0.4
81 0.33
82 0.28
83 0.23
84 0.21
85 0.18
86 0.16
87 0.13
88 0.13
89 0.14
90 0.12
91 0.11
92 0.11
93 0.12
94 0.13
95 0.13
96 0.16
97 0.19
98 0.22
99 0.21
100 0.21
101 0.24
102 0.26
103 0.31
104 0.29
105 0.32
106 0.34
107 0.39
108 0.38
109 0.41
110 0.37
111 0.33
112 0.33
113 0.27
114 0.24
115 0.22
116 0.23
117 0.19
118 0.2
119 0.19
120 0.17
121 0.16
122 0.14
123 0.1
124 0.08
125 0.07
126 0.05
127 0.04
128 0.04
129 0.03
130 0.03
131 0.04
132 0.04
133 0.06
134 0.06
135 0.07
136 0.09
137 0.11
138 0.14
139 0.15
140 0.16
141 0.15
142 0.16
143 0.17
144 0.18
145 0.19
146 0.22
147 0.25
148 0.26
149 0.26
150 0.34
151 0.39
152 0.42
153 0.42
154 0.43
155 0.46
156 0.53
157 0.58
158 0.55
159 0.53
160 0.59
161 0.55
162 0.56
163 0.59
164 0.62
165 0.64
166 0.64
167 0.65
168 0.61
169 0.67
170 0.7
171 0.64
172 0.62