Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZHM6

Protein Details
Accession E4ZHM6    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-42LNHKVGGPRKNTRSRRWYKDVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9.5, cyto_nucl 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
IPR028333  Ribosomal_S17_arc-typ  
IPR019979  Ribosomal_S17_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
PF16205  Ribosomal_S17_N  
PROSITE View protein in PROSITE  
PS00056  RIBOSOMAL_S17  
Amino Acid Sequences MATELTVQSERAYQKQPHIFLNHKVGGPRKNTRSRRWYKDVGLGFRTPKTAIEGTYIDKKCPFTGMVSIRGRILTGTVMSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLAAHVSPAFRAEPGDQVVVGQCRPLSKTVRFNVLRVLPRSGKAAKQFSKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.49
4 0.5
5 0.53
6 0.53
7 0.53
8 0.57
9 0.52
10 0.46
11 0.47
12 0.47
13 0.47
14 0.5
15 0.53
16 0.54
17 0.61
18 0.67
19 0.72
20 0.77
21 0.81
22 0.82
23 0.81
24 0.79
25 0.72
26 0.73
27 0.69
28 0.63
29 0.57
30 0.51
31 0.46
32 0.4
33 0.37
34 0.29
35 0.23
36 0.22
37 0.19
38 0.17
39 0.18
40 0.19
41 0.2
42 0.29
43 0.29
44 0.25
45 0.26
46 0.26
47 0.23
48 0.23
49 0.21
50 0.13
51 0.2
52 0.21
53 0.28
54 0.28
55 0.28
56 0.27
57 0.26
58 0.24
59 0.17
60 0.15
61 0.07
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.09
69 0.1
70 0.1
71 0.11
72 0.13
73 0.19
74 0.26
75 0.31
76 0.3
77 0.3
78 0.33
79 0.35
80 0.35
81 0.35
82 0.28
83 0.24
84 0.28
85 0.32
86 0.35
87 0.37
88 0.44
89 0.43
90 0.53
91 0.61
92 0.65
93 0.7
94 0.68
95 0.68
96 0.66
97 0.69
98 0.61
99 0.54
100 0.48
101 0.4
102 0.36
103 0.32
104 0.24
105 0.15
106 0.15
107 0.12
108 0.14
109 0.15
110 0.15
111 0.13
112 0.13
113 0.16
114 0.16
115 0.15
116 0.13
117 0.11
118 0.12
119 0.14
120 0.19
121 0.23
122 0.28
123 0.37
124 0.4
125 0.5
126 0.5
127 0.49
128 0.52
129 0.54
130 0.54
131 0.48
132 0.51
133 0.44
134 0.44
135 0.49
136 0.45
137 0.44
138 0.45
139 0.52