Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5AAV9

Protein Details
Accession E5AAV9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
308-329AGSWKNDKGGEEKRRRRRRVLLBasic
NLS Segment(s)
PositionSequence
315-326KGGEEKRRRRRR
Subcellular Location(s) plas 10, mito 4, cyto 3, extr 3, E.R. 3, pero 2, vacu 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007577  GlycoTrfase_DXD_sugar-bd_CS  
IPR029044  Nucleotide-diphossugar_trans  
IPR039367  Och1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0000009  F:alpha-1,6-mannosyltransferase activity  
GO:1901135  P:carbohydrate derivative metabolic process  
Pfam View protein in Pfam  
PF04488  Gly_transf_sug  
Amino Acid Sequences MVTRRIALSKVLSYPNLLALFILGLLYHFYALDAASTFGFIVPSLRHGGDSKVPRTGNIPKLLWYKLGPRGLSEELRNHTDTCIKPNPEYRATFMTDESSDAWVRETFSASRPDLVEAYLSLPVPIFKADILRYLLLWDKGGIWSDLDVSCKETPIDDWIPAEYKDKAQLVVGWEFDHGLPGNYIRQFTSWTIMSAPRSPYLALIIDDILADIGKLKAEHNITTQELTLKIAGDVVDFTGPRRLTRGIFTGLSNMLNRTVGPDDVKELVVPVLLGDVLIMPSISFALSMNVFKPEEKLSPELVTHHYAGSWKNDKGGEEKRRRRRRVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.29
4 0.25
5 0.19
6 0.15
7 0.14
8 0.12
9 0.11
10 0.05
11 0.04
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.06
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.08
29 0.08
30 0.11
31 0.14
32 0.14
33 0.15
34 0.16
35 0.2
36 0.26
37 0.33
38 0.32
39 0.36
40 0.36
41 0.35
42 0.4
43 0.45
44 0.45
45 0.44
46 0.42
47 0.41
48 0.46
49 0.46
50 0.43
51 0.37
52 0.36
53 0.36
54 0.41
55 0.35
56 0.32
57 0.36
58 0.37
59 0.39
60 0.35
61 0.34
62 0.32
63 0.36
64 0.36
65 0.32
66 0.29
67 0.33
68 0.3
69 0.32
70 0.36
71 0.35
72 0.37
73 0.43
74 0.48
75 0.47
76 0.48
77 0.44
78 0.4
79 0.4
80 0.38
81 0.31
82 0.28
83 0.22
84 0.21
85 0.19
86 0.17
87 0.14
88 0.13
89 0.14
90 0.12
91 0.13
92 0.13
93 0.14
94 0.12
95 0.15
96 0.2
97 0.19
98 0.21
99 0.2
100 0.2
101 0.18
102 0.17
103 0.14
104 0.1
105 0.1
106 0.1
107 0.09
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.08
116 0.08
117 0.11
118 0.13
119 0.13
120 0.12
121 0.13
122 0.15
123 0.13
124 0.13
125 0.1
126 0.09
127 0.09
128 0.1
129 0.09
130 0.07
131 0.06
132 0.08
133 0.08
134 0.09
135 0.08
136 0.11
137 0.11
138 0.12
139 0.11
140 0.1
141 0.1
142 0.14
143 0.15
144 0.12
145 0.12
146 0.12
147 0.14
148 0.14
149 0.16
150 0.11
151 0.1
152 0.13
153 0.13
154 0.13
155 0.11
156 0.12
157 0.13
158 0.14
159 0.14
160 0.11
161 0.1
162 0.11
163 0.1
164 0.1
165 0.07
166 0.06
167 0.06
168 0.06
169 0.1
170 0.1
171 0.11
172 0.1
173 0.1
174 0.12
175 0.13
176 0.15
177 0.12
178 0.12
179 0.13
180 0.15
181 0.17
182 0.18
183 0.19
184 0.17
185 0.17
186 0.17
187 0.15
188 0.15
189 0.14
190 0.11
191 0.1
192 0.09
193 0.08
194 0.08
195 0.07
196 0.06
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.1
205 0.12
206 0.14
207 0.15
208 0.18
209 0.19
210 0.19
211 0.2
212 0.17
213 0.15
214 0.15
215 0.13
216 0.1
217 0.09
218 0.09
219 0.09
220 0.07
221 0.07
222 0.07
223 0.08
224 0.07
225 0.08
226 0.13
227 0.14
228 0.14
229 0.17
230 0.19
231 0.19
232 0.22
233 0.26
234 0.23
235 0.24
236 0.25
237 0.24
238 0.23
239 0.23
240 0.21
241 0.18
242 0.15
243 0.14
244 0.13
245 0.13
246 0.14
247 0.14
248 0.14
249 0.14
250 0.16
251 0.17
252 0.18
253 0.14
254 0.13
255 0.12
256 0.1
257 0.09
258 0.06
259 0.05
260 0.05
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.03
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.07
274 0.08
275 0.1
276 0.11
277 0.14
278 0.15
279 0.15
280 0.18
281 0.2
282 0.22
283 0.25
284 0.28
285 0.27
286 0.29
287 0.29
288 0.3
289 0.3
290 0.3
291 0.27
292 0.24
293 0.22
294 0.22
295 0.24
296 0.3
297 0.32
298 0.29
299 0.33
300 0.35
301 0.36
302 0.42
303 0.49
304 0.51
305 0.56
306 0.66
307 0.72
308 0.81
309 0.87