Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5AAG7

Protein Details
Accession E5AAG7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-38GYARGSTRRERGKRVGRHFPLBasic
NLS Segment(s)
PositionSequence
225-238PKRGRGRPRKADIK
279-287GRKRLREFK
Subcellular Location(s) mito 16, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032054  Cdt1_C  
IPR038090  Cdt1_C_WH_dom_sf  
Gene Ontology GO:0007049  P:cell cycle  
Pfam View protein in Pfam  
PF16679  CDT1_C  
Amino Acid Sequences MSRTHGRSLDLCTLIGAGYARGSTRRERGKRVGRHFPLPLQWPAPRSLNNAVASPTPSLRILFAIDPFYLNTVSIVISSPAMSPIPIAPGQLPAELVSLLALHSSFLTALSLHYAHNGTSTPADLRDLTASTTLVWRQRKVTVDDVRLLIGILDHGPSGRHNPYYLSDYGRGKICIEIKDESPLMDGMTHMNEEGLQDMFKEGLDSLWQQWRISQNLATRPIAMPKRGRGRPRKADIKHARMETFLDDDAMSSFLAQLPLADVTACESLAALAPAQEKGRKRLREFKESVQHGRAQKKNRSSLGKENEPAILNQPVQAKITEFAAVRKTNLLDRILAKQEAAKIGPSAPTPAELARKAALQRTPEVLGVLSLLCANRPGIRVSFSMATFLQQLQGSIRTPISKEEAMKCVEVLASEVAPGYVSVVNMGTISSVVINQAMRPLDIKSRLVALGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.16
4 0.09
5 0.08
6 0.09
7 0.1
8 0.13
9 0.17
10 0.22
11 0.31
12 0.41
13 0.47
14 0.56
15 0.65
16 0.72
17 0.79
18 0.82
19 0.84
20 0.79
21 0.8
22 0.76
23 0.71
24 0.67
25 0.63
26 0.59
27 0.53
28 0.5
29 0.45
30 0.45
31 0.44
32 0.4
33 0.4
34 0.41
35 0.43
36 0.41
37 0.4
38 0.37
39 0.34
40 0.33
41 0.29
42 0.24
43 0.19
44 0.19
45 0.18
46 0.17
47 0.16
48 0.17
49 0.16
50 0.17
51 0.17
52 0.17
53 0.17
54 0.16
55 0.17
56 0.14
57 0.12
58 0.11
59 0.09
60 0.08
61 0.08
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.12
73 0.12
74 0.13
75 0.12
76 0.15
77 0.17
78 0.16
79 0.16
80 0.12
81 0.13
82 0.12
83 0.11
84 0.07
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.05
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.08
98 0.08
99 0.08
100 0.1
101 0.11
102 0.1
103 0.11
104 0.12
105 0.1
106 0.1
107 0.11
108 0.1
109 0.1
110 0.12
111 0.11
112 0.12
113 0.12
114 0.12
115 0.12
116 0.12
117 0.11
118 0.1
119 0.12
120 0.14
121 0.19
122 0.22
123 0.24
124 0.25
125 0.3
126 0.34
127 0.36
128 0.43
129 0.43
130 0.43
131 0.44
132 0.42
133 0.37
134 0.33
135 0.28
136 0.19
137 0.11
138 0.08
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.11
146 0.13
147 0.14
148 0.14
149 0.16
150 0.18
151 0.22
152 0.23
153 0.22
154 0.24
155 0.25
156 0.27
157 0.27
158 0.25
159 0.21
160 0.23
161 0.23
162 0.21
163 0.23
164 0.22
165 0.21
166 0.24
167 0.23
168 0.19
169 0.16
170 0.14
171 0.11
172 0.09
173 0.09
174 0.06
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.05
181 0.06
182 0.05
183 0.04
184 0.04
185 0.05
186 0.05
187 0.05
188 0.05
189 0.04
190 0.04
191 0.05
192 0.06
193 0.08
194 0.13
195 0.14
196 0.13
197 0.16
198 0.19
199 0.2
200 0.2
201 0.22
202 0.22
203 0.26
204 0.3
205 0.28
206 0.25
207 0.24
208 0.29
209 0.28
210 0.27
211 0.25
212 0.27
213 0.36
214 0.4
215 0.49
216 0.53
217 0.6
218 0.66
219 0.72
220 0.75
221 0.68
222 0.74
223 0.74
224 0.72
225 0.68
226 0.6
227 0.53
228 0.43
229 0.42
230 0.33
231 0.25
232 0.17
233 0.12
234 0.1
235 0.09
236 0.09
237 0.08
238 0.07
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.04
250 0.06
251 0.06
252 0.06
253 0.05
254 0.05
255 0.05
256 0.05
257 0.06
258 0.04
259 0.05
260 0.06
261 0.07
262 0.09
263 0.13
264 0.14
265 0.22
266 0.3
267 0.36
268 0.4
269 0.5
270 0.55
271 0.61
272 0.64
273 0.65
274 0.66
275 0.65
276 0.64
277 0.57
278 0.57
279 0.52
280 0.57
281 0.55
282 0.54
283 0.56
284 0.59
285 0.64
286 0.65
287 0.66
288 0.63
289 0.67
290 0.67
291 0.66
292 0.59
293 0.53
294 0.49
295 0.42
296 0.37
297 0.3
298 0.25
299 0.18
300 0.2
301 0.22
302 0.19
303 0.2
304 0.19
305 0.17
306 0.15
307 0.16
308 0.15
309 0.13
310 0.14
311 0.19
312 0.2
313 0.2
314 0.21
315 0.21
316 0.22
317 0.25
318 0.24
319 0.21
320 0.23
321 0.28
322 0.29
323 0.28
324 0.25
325 0.23
326 0.25
327 0.24
328 0.23
329 0.18
330 0.15
331 0.16
332 0.18
333 0.16
334 0.16
335 0.14
336 0.14
337 0.15
338 0.16
339 0.2
340 0.19
341 0.2
342 0.19
343 0.22
344 0.23
345 0.27
346 0.28
347 0.26
348 0.28
349 0.3
350 0.3
351 0.27
352 0.26
353 0.21
354 0.17
355 0.14
356 0.11
357 0.08
358 0.08
359 0.07
360 0.07
361 0.08
362 0.09
363 0.11
364 0.12
365 0.15
366 0.16
367 0.19
368 0.19
369 0.22
370 0.25
371 0.22
372 0.24
373 0.21
374 0.2
375 0.19
376 0.19
377 0.18
378 0.15
379 0.15
380 0.15
381 0.18
382 0.17
383 0.18
384 0.2
385 0.19
386 0.2
387 0.23
388 0.27
389 0.28
390 0.32
391 0.35
392 0.37
393 0.37
394 0.37
395 0.33
396 0.28
397 0.25
398 0.19
399 0.16
400 0.13
401 0.1
402 0.1
403 0.1
404 0.09
405 0.09
406 0.08
407 0.09
408 0.08
409 0.08
410 0.09
411 0.09
412 0.09
413 0.09
414 0.09
415 0.07
416 0.06
417 0.06
418 0.06
419 0.06
420 0.06
421 0.09
422 0.09
423 0.1
424 0.14
425 0.15
426 0.15
427 0.16
428 0.19
429 0.24
430 0.29
431 0.3
432 0.27
433 0.3