Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZUG5

Protein Details
Accession E4ZUG5    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-121IYYCCFIKKSRKARAERQTAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 7, extr 5, cyto 2, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MWFWEYVLYMYGQRYVLGQKVCPSGDLEPAYMNRNDQLLAYNATAASTTFATVTQTSAAETAGATDTSNTAQEKDDTPVAAIAGGVAGGVFALTAIAGFLIYYCCFIKKSRKARAERQTAEEQTNKEMQLRLQQHRDAPPDYTSPSHIPAPFHHSTDNSNSNNNNTYYAYTHPHEDQPPSPQELPIHSPNPNKSSPTHTRGPSELSADNTLSELETPDTTPKHHPGEFKQIPSAFVQTPPTEYTEEALHVRNGARGRGRRSRFVEMSPMGGVANGARDARSTDPVVARSAWVAPQDWGFYPPAVAEGGLRSQRGSRKGRGLGVDGVDDIMARMGRLERLDDQRAVRGGSKPCREDVGDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.23
4 0.23
5 0.24
6 0.26
7 0.31
8 0.31
9 0.3
10 0.3
11 0.26
12 0.31
13 0.3
14 0.26
15 0.24
16 0.26
17 0.29
18 0.27
19 0.26
20 0.21
21 0.2
22 0.19
23 0.17
24 0.17
25 0.16
26 0.18
27 0.17
28 0.17
29 0.15
30 0.15
31 0.15
32 0.12
33 0.11
34 0.08
35 0.08
36 0.07
37 0.08
38 0.1
39 0.1
40 0.11
41 0.11
42 0.1
43 0.11
44 0.11
45 0.1
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.12
56 0.11
57 0.11
58 0.12
59 0.15
60 0.16
61 0.19
62 0.2
63 0.17
64 0.17
65 0.16
66 0.15
67 0.13
68 0.1
69 0.07
70 0.05
71 0.04
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.04
88 0.04
89 0.06
90 0.07
91 0.08
92 0.1
93 0.14
94 0.24
95 0.33
96 0.43
97 0.52
98 0.61
99 0.67
100 0.76
101 0.83
102 0.83
103 0.77
104 0.73
105 0.71
106 0.64
107 0.61
108 0.55
109 0.45
110 0.38
111 0.38
112 0.32
113 0.26
114 0.24
115 0.21
116 0.26
117 0.31
118 0.33
119 0.36
120 0.38
121 0.4
122 0.44
123 0.47
124 0.4
125 0.35
126 0.31
127 0.28
128 0.27
129 0.24
130 0.22
131 0.2
132 0.2
133 0.22
134 0.21
135 0.21
136 0.21
137 0.28
138 0.26
139 0.26
140 0.24
141 0.22
142 0.23
143 0.27
144 0.33
145 0.26
146 0.28
147 0.27
148 0.28
149 0.3
150 0.28
151 0.23
152 0.17
153 0.17
154 0.15
155 0.17
156 0.18
157 0.16
158 0.18
159 0.17
160 0.2
161 0.21
162 0.22
163 0.21
164 0.23
165 0.24
166 0.26
167 0.24
168 0.22
169 0.21
170 0.21
171 0.24
172 0.24
173 0.24
174 0.24
175 0.27
176 0.29
177 0.33
178 0.32
179 0.29
180 0.27
181 0.32
182 0.36
183 0.38
184 0.41
185 0.38
186 0.39
187 0.39
188 0.41
189 0.34
190 0.31
191 0.26
192 0.22
193 0.21
194 0.19
195 0.18
196 0.14
197 0.13
198 0.09
199 0.08
200 0.07
201 0.06
202 0.06
203 0.07
204 0.09
205 0.1
206 0.13
207 0.17
208 0.21
209 0.25
210 0.27
211 0.31
212 0.33
213 0.43
214 0.45
215 0.43
216 0.43
217 0.39
218 0.38
219 0.35
220 0.34
221 0.23
222 0.21
223 0.23
224 0.18
225 0.19
226 0.19
227 0.2
228 0.17
229 0.17
230 0.16
231 0.14
232 0.15
233 0.15
234 0.15
235 0.13
236 0.13
237 0.13
238 0.16
239 0.16
240 0.19
241 0.24
242 0.28
243 0.36
244 0.44
245 0.47
246 0.52
247 0.57
248 0.62
249 0.58
250 0.54
251 0.55
252 0.46
253 0.44
254 0.36
255 0.3
256 0.21
257 0.18
258 0.16
259 0.08
260 0.08
261 0.07
262 0.07
263 0.07
264 0.08
265 0.1
266 0.13
267 0.16
268 0.16
269 0.19
270 0.22
271 0.23
272 0.25
273 0.23
274 0.21
275 0.18
276 0.18
277 0.16
278 0.15
279 0.14
280 0.14
281 0.15
282 0.16
283 0.16
284 0.17
285 0.16
286 0.15
287 0.14
288 0.13
289 0.12
290 0.1
291 0.1
292 0.08
293 0.09
294 0.14
295 0.16
296 0.16
297 0.16
298 0.21
299 0.27
300 0.36
301 0.41
302 0.42
303 0.49
304 0.54
305 0.59
306 0.57
307 0.55
308 0.51
309 0.46
310 0.4
311 0.31
312 0.26
313 0.2
314 0.16
315 0.12
316 0.09
317 0.07
318 0.06
319 0.08
320 0.09
321 0.12
322 0.13
323 0.17
324 0.22
325 0.3
326 0.35
327 0.38
328 0.39
329 0.42
330 0.43
331 0.41
332 0.39
333 0.38
334 0.42
335 0.48
336 0.54
337 0.51
338 0.51
339 0.54