Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZRU1

Protein Details
Accession E4ZRU1    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32TESAPAQYKQPSRKGKKAWRKNVDVTEIQHydrophilic
264-299EEKLKVKRPERKSLSQRNKIKRRKEAERKAIHEKKMBasic
NLS Segment(s)
PositionSequence
16-22RKGKKAW
106-112GKRKKSK
185-186KP
267-322LKVKRPERKSLSQRNKIKRRKEAERKAIHEKKMKAKEQQVQEIKKLAKSVEAKEKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MADTESAPAQYKQPSRKGKKAWRKNVDVTEIQSGLEDVRDQIITGGVIAEKPSDQLFAVDTIGSADIQKATARRHKPLKVDQILAQRSAVPAVPSRKRLSEIADDGKRKKSKVSGKEFDRLRAIAYGGDQTKKDIVQTGNTADYDPWAVQEVKKDPRFTFLKEKKAKVAPVTLKHAPISQAKSGKPIPSVRKPAGGKSYNPKFEDWQNELMRESDKAVEAEKKRLQEAREEAERMERAAVESEDDSGEESVWESEWEGFSGDEEEKLKVKRPERKSLSQRNKIKRRKEAERKAIHEKKMKAKEQQVQEIKKLAKSVEAKEKARDAVRKALEDKVNEVVSEDEGGEIELRKKQFGKAPIPEAPLEVVLPDELRDSLRLLKPEGNLLKDRFYTMMLQGKVEARRQIPYAKQRKYTVSEKWSYKDWQLPKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.75
4 0.82
5 0.85
6 0.88
7 0.9
8 0.92
9 0.91
10 0.9
11 0.9
12 0.88
13 0.84
14 0.76
15 0.69
16 0.64
17 0.54
18 0.45
19 0.36
20 0.27
21 0.2
22 0.17
23 0.14
24 0.08
25 0.1
26 0.1
27 0.1
28 0.1
29 0.11
30 0.09
31 0.09
32 0.09
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.1
42 0.1
43 0.11
44 0.11
45 0.12
46 0.1
47 0.09
48 0.09
49 0.1
50 0.09
51 0.08
52 0.08
53 0.07
54 0.08
55 0.11
56 0.13
57 0.2
58 0.29
59 0.35
60 0.43
61 0.52
62 0.57
63 0.64
64 0.71
65 0.74
66 0.71
67 0.69
68 0.66
69 0.67
70 0.63
71 0.55
72 0.46
73 0.35
74 0.3
75 0.27
76 0.22
77 0.14
78 0.17
79 0.25
80 0.3
81 0.34
82 0.37
83 0.38
84 0.4
85 0.41
86 0.4
87 0.4
88 0.41
89 0.44
90 0.48
91 0.52
92 0.52
93 0.59
94 0.57
95 0.5
96 0.48
97 0.48
98 0.51
99 0.56
100 0.63
101 0.64
102 0.66
103 0.73
104 0.7
105 0.64
106 0.58
107 0.48
108 0.39
109 0.31
110 0.25
111 0.18
112 0.17
113 0.18
114 0.17
115 0.19
116 0.18
117 0.18
118 0.19
119 0.19
120 0.18
121 0.18
122 0.17
123 0.18
124 0.21
125 0.22
126 0.22
127 0.22
128 0.22
129 0.16
130 0.16
131 0.14
132 0.11
133 0.09
134 0.1
135 0.1
136 0.11
137 0.16
138 0.21
139 0.29
140 0.33
141 0.36
142 0.34
143 0.4
144 0.42
145 0.42
146 0.47
147 0.46
148 0.53
149 0.56
150 0.58
151 0.58
152 0.6
153 0.58
154 0.49
155 0.51
156 0.47
157 0.44
158 0.49
159 0.44
160 0.41
161 0.38
162 0.37
163 0.31
164 0.29
165 0.28
166 0.27
167 0.29
168 0.28
169 0.32
170 0.34
171 0.33
172 0.32
173 0.35
174 0.38
175 0.41
176 0.48
177 0.44
178 0.49
179 0.48
180 0.48
181 0.5
182 0.45
183 0.4
184 0.43
185 0.49
186 0.47
187 0.48
188 0.44
189 0.38
190 0.4
191 0.43
192 0.37
193 0.38
194 0.33
195 0.32
196 0.31
197 0.3
198 0.25
199 0.19
200 0.17
201 0.1
202 0.09
203 0.09
204 0.1
205 0.16
206 0.17
207 0.24
208 0.25
209 0.26
210 0.27
211 0.3
212 0.29
213 0.29
214 0.32
215 0.3
216 0.31
217 0.31
218 0.29
219 0.29
220 0.29
221 0.22
222 0.19
223 0.13
224 0.1
225 0.11
226 0.11
227 0.08
228 0.08
229 0.08
230 0.08
231 0.08
232 0.08
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.08
248 0.07
249 0.08
250 0.09
251 0.1
252 0.13
253 0.14
254 0.2
255 0.24
256 0.32
257 0.4
258 0.46
259 0.56
260 0.61
261 0.7
262 0.74
263 0.79
264 0.83
265 0.83
266 0.86
267 0.86
268 0.89
269 0.88
270 0.87
271 0.86
272 0.84
273 0.85
274 0.87
275 0.87
276 0.86
277 0.86
278 0.83
279 0.84
280 0.83
281 0.79
282 0.76
283 0.71
284 0.71
285 0.71
286 0.71
287 0.68
288 0.69
289 0.69
290 0.68
291 0.72
292 0.7
293 0.64
294 0.61
295 0.6
296 0.53
297 0.47
298 0.42
299 0.32
300 0.31
301 0.32
302 0.35
303 0.4
304 0.45
305 0.46
306 0.47
307 0.5
308 0.47
309 0.48
310 0.47
311 0.41
312 0.43
313 0.44
314 0.45
315 0.44
316 0.47
317 0.46
318 0.41
319 0.4
320 0.36
321 0.33
322 0.28
323 0.26
324 0.2
325 0.16
326 0.16
327 0.13
328 0.08
329 0.07
330 0.08
331 0.08
332 0.08
333 0.1
334 0.14
335 0.15
336 0.18
337 0.2
338 0.24
339 0.3
340 0.37
341 0.44
342 0.47
343 0.53
344 0.55
345 0.57
346 0.53
347 0.47
348 0.4
349 0.31
350 0.24
351 0.17
352 0.12
353 0.09
354 0.09
355 0.08
356 0.08
357 0.08
358 0.09
359 0.1
360 0.11
361 0.18
362 0.22
363 0.24
364 0.27
365 0.31
366 0.31
367 0.4
368 0.42
369 0.4
370 0.42
371 0.42
372 0.44
373 0.4
374 0.41
375 0.32
376 0.3
377 0.28
378 0.27
379 0.33
380 0.29
381 0.28
382 0.29
383 0.34
384 0.37
385 0.38
386 0.39
387 0.33
388 0.36
389 0.39
390 0.43
391 0.47
392 0.54
393 0.6
394 0.61
395 0.67
396 0.69
397 0.73
398 0.72
399 0.71
400 0.7
401 0.69
402 0.7
403 0.68
404 0.66
405 0.64
406 0.62
407 0.6
408 0.59
409 0.56