Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZJ02

Protein Details
Accession E4ZJ02   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-61AAPKSPSERRMRGKRGKRGKRFMRYNAPABasic
NLS Segment(s)
PositionSequence
36-53KSPSERRMRGKRGKRGKR
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSGSFPNRSILIPFMLVLPPAHDSPFLMDQHDAAPKSPSERRMRGKRGKRGKRFMRYNAPAISETGGPKVPRAQTCVIQLHGLMYYKTLPPQPQLKHHRNAFKMRIPRHEYNTQRHTTISCKAPNAVHIHRERSVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.12
6 0.13
7 0.13
8 0.13
9 0.12
10 0.12
11 0.15
12 0.2
13 0.19
14 0.18
15 0.17
16 0.17
17 0.2
18 0.24
19 0.2
20 0.16
21 0.17
22 0.16
23 0.21
24 0.25
25 0.3
26 0.34
27 0.42
28 0.51
29 0.59
30 0.69
31 0.74
32 0.8
33 0.82
34 0.85
35 0.87
36 0.88
37 0.88
38 0.88
39 0.88
40 0.87
41 0.84
42 0.84
43 0.77
44 0.72
45 0.63
46 0.55
47 0.45
48 0.38
49 0.31
50 0.21
51 0.17
52 0.14
53 0.14
54 0.11
55 0.11
56 0.14
57 0.17
58 0.17
59 0.21
60 0.22
61 0.22
62 0.27
63 0.29
64 0.26
65 0.22
66 0.21
67 0.17
68 0.16
69 0.14
70 0.09
71 0.08
72 0.09
73 0.09
74 0.11
75 0.13
76 0.13
77 0.17
78 0.26
79 0.28
80 0.37
81 0.46
82 0.52
83 0.58
84 0.63
85 0.68
86 0.66
87 0.71
88 0.68
89 0.66
90 0.68
91 0.65
92 0.68
93 0.68
94 0.68
95 0.66
96 0.69
97 0.68
98 0.69
99 0.72
100 0.65
101 0.58
102 0.53
103 0.48
104 0.43
105 0.43
106 0.41
107 0.37
108 0.36
109 0.39
110 0.39
111 0.42
112 0.46
113 0.44
114 0.45
115 0.46
116 0.5