Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZP14

Protein Details
Accession E4ZP14    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-89DPGRRRTGSERAKRRQQQPCGKPHQRSRYGHBasic
NLS Segment(s)
PositionSequence
61-95GRRRTGSERAKRRQQQPCGKPHQRSRYGHPHKGTR
Subcellular Location(s) nucl 16, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MYEIREFEQGRHMKRCLSAWPQSVTLQRRLAEQHSLPLFSTHKKNPTLASNSAHDGGGDPGRRRTGSERAKRRQQQPCGKPHQRSRYGHPHKGTREDPRKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.42
4 0.43
5 0.45
6 0.43
7 0.45
8 0.44
9 0.45
10 0.49
11 0.45
12 0.44
13 0.41
14 0.36
15 0.35
16 0.36
17 0.35
18 0.33
19 0.29
20 0.3
21 0.27
22 0.27
23 0.24
24 0.24
25 0.23
26 0.21
27 0.27
28 0.24
29 0.29
30 0.3
31 0.31
32 0.31
33 0.35
34 0.37
35 0.34
36 0.33
37 0.29
38 0.29
39 0.28
40 0.25
41 0.18
42 0.14
43 0.12
44 0.13
45 0.14
46 0.14
47 0.15
48 0.18
49 0.18
50 0.19
51 0.23
52 0.3
53 0.37
54 0.47
55 0.55
56 0.62
57 0.72
58 0.78
59 0.83
60 0.83
61 0.83
62 0.84
63 0.82
64 0.84
65 0.84
66 0.85
67 0.84
68 0.84
69 0.84
70 0.83
71 0.79
72 0.78
73 0.79
74 0.8
75 0.8
76 0.77
77 0.76
78 0.73
79 0.76
80 0.74
81 0.74