Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZME0

Protein Details
Accession E4ZME0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-67AVLKHVSRCAKKRKRQYPDTRHPIHQLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MKTMHGEKLKPIASAFSPRFRQWSRCPCPTYGNTVFQKAPAVLKHVSRCAKKRKRQYPDTRHPIHQLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.36
5 0.36
6 0.43
7 0.43
8 0.47
9 0.48
10 0.56
11 0.56
12 0.59
13 0.61
14 0.56
15 0.59
16 0.54
17 0.53
18 0.46
19 0.45
20 0.39
21 0.39
22 0.37
23 0.31
24 0.3
25 0.22
26 0.2
27 0.13
28 0.16
29 0.15
30 0.19
31 0.22
32 0.28
33 0.35
34 0.39
35 0.47
36 0.54
37 0.63
38 0.68
39 0.77
40 0.8
41 0.83
42 0.88
43 0.91
44 0.91
45 0.92
46 0.93
47 0.88
48 0.82
49 0.78