Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B5RTC0

Protein Details
Accession B5RTC0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
392-420EEYEYSISSRKRKRRNKDKPAPKSDNEFSHydrophilic
NLS Segment(s)
PositionSequence
401-414RKRKRRNKDKPAPK
Subcellular Location(s) nucl 8.5, cyto_nucl 7.5, cyto 5.5, E.R. 5, mito 2, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR007751  DUF676_lipase-like  
IPR044294  Lipase-like  
Gene Ontology GO:0016042  P:lipid catabolic process  
KEGG dha:DEHA2C14960g  -  
Pfam View protein in Pfam  
PF05057  DUF676  
Amino Acid Sequences MVDYHLVILVHGLWGTCSHMDYLESQIKQIKSLNKDENIITYKTISHGGFLTYDGIDVNGKRIANEITAETDKLTSNGNGVKKFSILGYSLGGLISRYAIGVLYYEGYFEKVLPVNFITFCTPHVGAIKPYRSFSAKMFNGFSSYFLAHSGAQMFLKDKQPVKSEYGGNNDLNLPLLVWMAEPSSTFYIALSKFKHRMVYANAIGDKRAGFFTAAIATMDPFSSMVDRNVSAYDFEYVKGYEPTVIDFTKPISFSRIDETNTTPVYPIWSIIVKWVKLLVGIILVTPLWGLWFLYKTISERIKLNKRVSSFFNETSLLYLYSYPDHIFDDITSEDETPQPKNEKSELELNDKDGPHESFIYSLEKELGEQVRDQTDIFVDSIFDAANSQSYEEYEYSISSRKRKRRNKDKPAPKSDNEFSSTINEMENLNDSSDPLLSQSKLVTLKGKKIDDFRLKLSSNELYIIQKLNKLDWEKYPVIIRKTALTHSAAIVRQDEPAFEEGKTVVRHFVEQAFKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.11
4 0.11
5 0.11
6 0.12
7 0.13
8 0.15
9 0.21
10 0.26
11 0.25
12 0.27
13 0.33
14 0.32
15 0.34
16 0.38
17 0.39
18 0.38
19 0.47
20 0.54
21 0.5
22 0.53
23 0.52
24 0.53
25 0.5
26 0.44
27 0.36
28 0.29
29 0.27
30 0.25
31 0.29
32 0.21
33 0.19
34 0.18
35 0.18
36 0.17
37 0.17
38 0.18
39 0.12
40 0.12
41 0.11
42 0.11
43 0.12
44 0.11
45 0.13
46 0.15
47 0.15
48 0.15
49 0.17
50 0.18
51 0.17
52 0.19
53 0.17
54 0.19
55 0.21
56 0.21
57 0.19
58 0.19
59 0.18
60 0.17
61 0.18
62 0.13
63 0.15
64 0.21
65 0.25
66 0.26
67 0.28
68 0.28
69 0.26
70 0.26
71 0.23
72 0.2
73 0.16
74 0.15
75 0.14
76 0.14
77 0.13
78 0.13
79 0.12
80 0.09
81 0.08
82 0.07
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.09
95 0.09
96 0.09
97 0.11
98 0.13
99 0.13
100 0.15
101 0.15
102 0.16
103 0.17
104 0.18
105 0.17
106 0.14
107 0.15
108 0.18
109 0.17
110 0.16
111 0.19
112 0.19
113 0.22
114 0.29
115 0.34
116 0.31
117 0.32
118 0.34
119 0.34
120 0.34
121 0.32
122 0.34
123 0.31
124 0.32
125 0.33
126 0.31
127 0.31
128 0.29
129 0.27
130 0.2
131 0.18
132 0.15
133 0.13
134 0.15
135 0.12
136 0.12
137 0.12
138 0.1
139 0.1
140 0.11
141 0.12
142 0.14
143 0.18
144 0.22
145 0.25
146 0.29
147 0.33
148 0.35
149 0.38
150 0.4
151 0.41
152 0.4
153 0.43
154 0.42
155 0.38
156 0.36
157 0.32
158 0.27
159 0.22
160 0.17
161 0.11
162 0.06
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.07
171 0.08
172 0.08
173 0.08
174 0.08
175 0.12
176 0.13
177 0.17
178 0.18
179 0.22
180 0.25
181 0.26
182 0.3
183 0.26
184 0.3
185 0.3
186 0.35
187 0.33
188 0.33
189 0.34
190 0.31
191 0.31
192 0.27
193 0.22
194 0.15
195 0.13
196 0.09
197 0.07
198 0.07
199 0.08
200 0.08
201 0.08
202 0.07
203 0.07
204 0.06
205 0.06
206 0.06
207 0.05
208 0.04
209 0.04
210 0.05
211 0.06
212 0.07
213 0.08
214 0.08
215 0.09
216 0.09
217 0.09
218 0.09
219 0.08
220 0.1
221 0.09
222 0.09
223 0.09
224 0.09
225 0.1
226 0.1
227 0.09
228 0.09
229 0.08
230 0.09
231 0.11
232 0.11
233 0.1
234 0.1
235 0.11
236 0.12
237 0.12
238 0.11
239 0.12
240 0.13
241 0.13
242 0.17
243 0.18
244 0.17
245 0.18
246 0.2
247 0.2
248 0.2
249 0.19
250 0.16
251 0.13
252 0.14
253 0.12
254 0.1
255 0.08
256 0.08
257 0.08
258 0.13
259 0.17
260 0.14
261 0.15
262 0.15
263 0.13
264 0.13
265 0.13
266 0.08
267 0.05
268 0.05
269 0.04
270 0.04
271 0.04
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.04
279 0.05
280 0.05
281 0.06
282 0.07
283 0.09
284 0.15
285 0.17
286 0.18
287 0.21
288 0.29
289 0.38
290 0.45
291 0.48
292 0.47
293 0.47
294 0.49
295 0.48
296 0.47
297 0.43
298 0.37
299 0.34
300 0.31
301 0.28
302 0.26
303 0.24
304 0.16
305 0.11
306 0.1
307 0.09
308 0.09
309 0.1
310 0.09
311 0.09
312 0.09
313 0.09
314 0.09
315 0.08
316 0.1
317 0.09
318 0.1
319 0.1
320 0.1
321 0.1
322 0.12
323 0.14
324 0.13
325 0.17
326 0.2
327 0.2
328 0.24
329 0.27
330 0.26
331 0.28
332 0.35
333 0.35
334 0.38
335 0.37
336 0.36
337 0.38
338 0.36
339 0.33
340 0.28
341 0.25
342 0.19
343 0.19
344 0.16
345 0.12
346 0.14
347 0.16
348 0.14
349 0.14
350 0.13
351 0.12
352 0.12
353 0.16
354 0.16
355 0.14
356 0.15
357 0.16
358 0.17
359 0.17
360 0.17
361 0.13
362 0.12
363 0.12
364 0.11
365 0.09
366 0.08
367 0.07
368 0.07
369 0.07
370 0.06
371 0.05
372 0.05
373 0.07
374 0.07
375 0.07
376 0.07
377 0.08
378 0.11
379 0.11
380 0.12
381 0.11
382 0.11
383 0.12
384 0.18
385 0.22
386 0.29
387 0.38
388 0.46
389 0.57
390 0.66
391 0.76
392 0.82
393 0.89
394 0.91
395 0.93
396 0.95
397 0.95
398 0.96
399 0.93
400 0.85
401 0.82
402 0.75
403 0.69
404 0.62
405 0.52
406 0.42
407 0.38
408 0.35
409 0.27
410 0.23
411 0.18
412 0.15
413 0.15
414 0.16
415 0.13
416 0.13
417 0.12
418 0.12
419 0.12
420 0.12
421 0.11
422 0.1
423 0.13
424 0.12
425 0.13
426 0.13
427 0.17
428 0.19
429 0.21
430 0.27
431 0.28
432 0.36
433 0.43
434 0.47
435 0.46
436 0.5
437 0.58
438 0.6
439 0.6
440 0.57
441 0.57
442 0.54
443 0.5
444 0.5
445 0.43
446 0.34
447 0.31
448 0.28
449 0.23
450 0.25
451 0.29
452 0.25
453 0.26
454 0.26
455 0.27
456 0.32
457 0.34
458 0.35
459 0.36
460 0.42
461 0.4
462 0.42
463 0.48
464 0.47
465 0.47
466 0.47
467 0.42
468 0.4
469 0.42
470 0.42
471 0.38
472 0.34
473 0.31
474 0.3
475 0.34
476 0.3
477 0.29
478 0.29
479 0.25
480 0.26
481 0.25
482 0.23
483 0.2
484 0.21
485 0.2
486 0.18
487 0.19
488 0.15
489 0.21
490 0.23
491 0.21
492 0.24
493 0.24
494 0.26
495 0.27
496 0.34
497 0.35