Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A1R4

Protein Details
Accession E5A1R4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32AYLKRNRNIGKGKKQNKRPGGAGHydrophilic
NLS Segment(s)
PositionSequence
13-30KRNRNIGKGKKQNKRPGG
Subcellular Location(s) mito 15, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019340  Histone_AcTrfase_su3  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10198  Ada3  
Amino Acid Sequences MGRGNNLNAAYLKRNRNIGKGKKQNKRPGGAGGGSHAVANAGITRPGVGEPIRTLMERRQQWISTIGPVVNYGKTGLPTSTIFDEEKMKELENREVEIWNTEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.54
4 0.61
5 0.64
6 0.68
7 0.72
8 0.78
9 0.8
10 0.87
11 0.88
12 0.86
13 0.81
14 0.73
15 0.68
16 0.63
17 0.55
18 0.45
19 0.36
20 0.29
21 0.24
22 0.21
23 0.15
24 0.09
25 0.07
26 0.07
27 0.05
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.07
35 0.06
36 0.07
37 0.07
38 0.09
39 0.1
40 0.1
41 0.11
42 0.14
43 0.21
44 0.22
45 0.25
46 0.26
47 0.25
48 0.27
49 0.29
50 0.26
51 0.2
52 0.2
53 0.17
54 0.13
55 0.15
56 0.14
57 0.11
58 0.11
59 0.1
60 0.09
61 0.1
62 0.11
63 0.1
64 0.12
65 0.12
66 0.15
67 0.15
68 0.17
69 0.16
70 0.17
71 0.22
72 0.2
73 0.23
74 0.22
75 0.21
76 0.23
77 0.26
78 0.33
79 0.31
80 0.33
81 0.3
82 0.31
83 0.3
84 0.29
85 0.27