Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135LB18

Protein Details
Accession A0A135LB18   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
58-77SDNTEKKGRKHAPPKRKSVDBasic
NLS Segment(s)
PositionSequence
63-74KKGRKHAPPKRK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MDCEDDESTESYIFYYGRAPISWSSNKQDPVAPSSTVAVYVTLDGVEKPTQIPICMDSDNTEKKGRKHAPPKRKSVDGWGEVQREKEPQYVNKTQCSHCDIEDLPVRNCYHLLKEPIYED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.13
6 0.15
7 0.17
8 0.24
9 0.29
10 0.31
11 0.35
12 0.39
13 0.41
14 0.4
15 0.41
16 0.37
17 0.36
18 0.34
19 0.28
20 0.23
21 0.22
22 0.21
23 0.17
24 0.15
25 0.1
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.07
33 0.07
34 0.07
35 0.07
36 0.09
37 0.1
38 0.1
39 0.1
40 0.1
41 0.12
42 0.12
43 0.12
44 0.11
45 0.16
46 0.17
47 0.19
48 0.23
49 0.23
50 0.25
51 0.35
52 0.39
53 0.44
54 0.53
55 0.61
56 0.66
57 0.72
58 0.8
59 0.75
60 0.74
61 0.66
62 0.64
63 0.62
64 0.54
65 0.51
66 0.46
67 0.44
68 0.41
69 0.41
70 0.33
71 0.27
72 0.26
73 0.26
74 0.25
75 0.28
76 0.35
77 0.43
78 0.44
79 0.5
80 0.52
81 0.49
82 0.51
83 0.5
84 0.44
85 0.36
86 0.37
87 0.3
88 0.32
89 0.37
90 0.35
91 0.31
92 0.34
93 0.34
94 0.31
95 0.32
96 0.28
97 0.28
98 0.31
99 0.36
100 0.33