Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZWU2

Protein Details
Accession E4ZWU2   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPYRLSRHQKYRQRERLRHVDTVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, mito_nucl 13.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRLTNPLSGGLLWKIPYRLSRHQKYRQRERLRHVDTVVSTLDTALRRLGSSMKKVERWKAEMPTEAEMLPKDKYSVFDRKVKRYRKGIHIYMLTTSSGNTEVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.16
6 0.18
7 0.23
8 0.29
9 0.38
10 0.46
11 0.54
12 0.62
13 0.71
14 0.78
15 0.83
16 0.87
17 0.87
18 0.88
19 0.86
20 0.84
21 0.85
22 0.81
23 0.75
24 0.65
25 0.58
26 0.47
27 0.41
28 0.33
29 0.22
30 0.17
31 0.13
32 0.14
33 0.1
34 0.11
35 0.09
36 0.09
37 0.08
38 0.09
39 0.15
40 0.15
41 0.19
42 0.25
43 0.27
44 0.32
45 0.35
46 0.4
47 0.39
48 0.41
49 0.41
50 0.39
51 0.38
52 0.36
53 0.36
54 0.31
55 0.28
56 0.23
57 0.2
58 0.15
59 0.15
60 0.12
61 0.1
62 0.09
63 0.09
64 0.12
65 0.17
66 0.26
67 0.28
68 0.36
69 0.42
70 0.51
71 0.6
72 0.66
73 0.68
74 0.69
75 0.73
76 0.75
77 0.78
78 0.73
79 0.71
80 0.65
81 0.59
82 0.51
83 0.44
84 0.35
85 0.26
86 0.21
87 0.15
88 0.12
89 0.12
90 0.11
91 0.11
92 0.17
93 0.2
94 0.23
95 0.25
96 0.3
97 0.39
98 0.45
99 0.53
100 0.55
101 0.63