FuNGI

A0A135LQ68

Protein Details

Accession

A0A135LQ68

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
25-55	SSWDKCMAKSYCKRRNKTPKHFDDPQFHQPP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 22.5, cyto_nucl 15, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR037504 PSI_induc_2

Amino Acid Sequences

MSPANITLWARDTVSDLESVPSTFSSWDKCMAKSYCKRRNKTPKHFDDPQFHQPPPPAVNPVYQASPAPPSYRGAQQRAPSFRGAQQTAHFDSPKTPAAHVNEDALPEMPTWAGAVDKHVEDPNHRDDVEMEPLNPPDRKQGAGTPGVAYSDYSPNPTMGGAGAGYRGFGPTDPHARRSPGPGVALNPVQDPYGRRSPGMPSPGAAIDPYSRRSPGPGAALSAAQDPYARRSPGPPVALAASQDPYGRRSPGMPTPVQAAGYGSAAHDPYGPRSPGLTSPVGAPVHNPYDQQQYNDHSYAGNGYHAVTAPSPVAAYKPHTNYSPVPMSFSPSSEMDHSAAAAPTQGFQRQPSFGSSQYPPTYTSQPPYRTFSPGASSSPPPAFSAPSPSEYTSYNPHANTTPVPEPDNNRPPSLLQSGKKPNLNASSNF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.19
3	0.16
4	0.17
5	0.17
6	0.17
7	0.14
8	0.13
9	0.12
10	0.13
11	0.14
12	0.17
13	0.19
14	0.27
15	0.28
16	0.29
17	0.36
18	0.4
19	0.48
20	0.53
21	0.62
22	0.64
23	0.72
24	0.77
25	0.8
26	0.87
27	0.88
28	0.89
29	0.89
30	0.89
31	0.88
32	0.92
33	0.88
34	0.86
35	0.83
36	0.82
37	0.76
38	0.66
39	0.61
40	0.55
41	0.53
42	0.49
43	0.44
44	0.38
45	0.35
46	0.37
47	0.37
48	0.35
49	0.31
50	0.27
51	0.24
52	0.21
53	0.24
54	0.22
55	0.21
56	0.21
57	0.21
58	0.24
59	0.31
60	0.37
61	0.38
62	0.42
63	0.46
64	0.53
65	0.56
66	0.56
67	0.51
68	0.47
69	0.46
70	0.48
71	0.43
72	0.38
73	0.36
74	0.39
75	0.4
76	0.41
77	0.36
78	0.29
79	0.3
80	0.31
81	0.34
82	0.29
83	0.26
84	0.28
85	0.33
86	0.37
87	0.35
88	0.34
89	0.29
90	0.28
91	0.27
92	0.22
93	0.17
94	0.12
95	0.12
96	0.08
97	0.07
98	0.06
99	0.06
100	0.06
101	0.05
102	0.08
103	0.1
104	0.1
105	0.12
106	0.15
107	0.16
108	0.18
109	0.23
110	0.26
111	0.27
112	0.26
113	0.24
114	0.23
115	0.26
116	0.3
117	0.25
118	0.21
119	0.2
120	0.21
121	0.24
122	0.24
123	0.2
124	0.21
125	0.22
126	0.23
127	0.23
128	0.26
129	0.28
130	0.3
131	0.3
132	0.23
133	0.22
134	0.21
135	0.19
136	0.15
137	0.12
138	0.14
139	0.13
140	0.14
141	0.15
142	0.14
143	0.14
144	0.14
145	0.12
146	0.07
147	0.08
148	0.05
149	0.05
150	0.06
151	0.05
152	0.05
153	0.05
154	0.05
155	0.05
156	0.05
157	0.08
158	0.1
159	0.2
160	0.22
161	0.26
162	0.27
163	0.3
164	0.31
165	0.34
166	0.34
167	0.28
168	0.28
169	0.25
170	0.25
171	0.25
172	0.25
173	0.2
174	0.16
175	0.14
176	0.12
177	0.12
178	0.12
179	0.15
180	0.21
181	0.21
182	0.2
183	0.21
184	0.25
185	0.29
186	0.31
187	0.25
188	0.19
189	0.2
190	0.2
191	0.18
192	0.15
193	0.11
194	0.09
195	0.11
196	0.13
197	0.12
198	0.13
199	0.13
200	0.14
201	0.15
202	0.16
203	0.18
204	0.15
205	0.15
206	0.15
207	0.15
208	0.14
209	0.14
210	0.11
211	0.07
212	0.08
213	0.07
214	0.11
215	0.15
216	0.15
217	0.14
218	0.16
219	0.21
220	0.26
221	0.27
222	0.23
223	0.2
224	0.21
225	0.21
226	0.2
227	0.15
228	0.1
229	0.1
230	0.11
231	0.1
232	0.12
233	0.13
234	0.14
235	0.13
236	0.14
237	0.17
238	0.21
239	0.26
240	0.23
241	0.22
242	0.25
243	0.25
244	0.24
245	0.2
246	0.15
247	0.11
248	0.11
249	0.1
250	0.07
251	0.07
252	0.07
253	0.07
254	0.08
255	0.08
256	0.11
257	0.16
258	0.16
259	0.15
260	0.16
261	0.18
262	0.18
263	0.22
264	0.2
265	0.15
266	0.16
267	0.21
268	0.2
269	0.19
270	0.17
271	0.17
272	0.19
273	0.2
274	0.19
275	0.16
276	0.25
277	0.26
278	0.27
279	0.27
280	0.28
281	0.33
282	0.33
283	0.31
284	0.22
285	0.21
286	0.21
287	0.18
288	0.14
289	0.09
290	0.09
291	0.09
292	0.09
293	0.1
294	0.08
295	0.09
296	0.08
297	0.08
298	0.07
299	0.07
300	0.08
301	0.09
302	0.14
303	0.19
304	0.23
305	0.26
306	0.27
307	0.31
308	0.32
309	0.37
310	0.39
311	0.32
312	0.33
313	0.31
314	0.36
315	0.32
316	0.31
317	0.28
318	0.21
319	0.23
320	0.2
321	0.22
322	0.17
323	0.16
324	0.16
325	0.14
326	0.14
327	0.12
328	0.11
329	0.09
330	0.1
331	0.12
332	0.14
333	0.14
334	0.17
335	0.21
336	0.21
337	0.23
338	0.25
339	0.27
340	0.25
341	0.29
342	0.29
343	0.33
344	0.33
345	0.33
346	0.31
347	0.32
348	0.37
349	0.35
350	0.4
351	0.41
352	0.45
353	0.48
354	0.52
355	0.51
356	0.51
357	0.5
358	0.45
359	0.42
360	0.38
361	0.37
362	0.35
363	0.35
364	0.34
365	0.34
366	0.33
367	0.29
368	0.28
369	0.27
370	0.24
371	0.3
372	0.28
373	0.3
374	0.32
375	0.32
376	0.32
377	0.3
378	0.32
379	0.31
380	0.34
381	0.35
382	0.32
383	0.33
384	0.34
385	0.35
386	0.35
387	0.35
388	0.34
389	0.32
390	0.36
391	0.37
392	0.42
393	0.49
394	0.56
395	0.53
396	0.49
397	0.47
398	0.45
399	0.47
400	0.49
401	0.47
402	0.41
403	0.48
404	0.56
405	0.62
406	0.65
407	0.61
408	0.61
409	0.61

A0A135LQ68

3D AlphaFold-predicted Structure Viewer