Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A3X1

Protein Details
Accession E5A3X1    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-42SNGRNKKGRGHVKPIRCSNCHydrophilic
97-132GKIVRVRSREGRRNRAPPPRVRYNKDGKKINPNQAAHydrophilic
NLS Segment(s)
PositionSequence
19-34KKRASNGRNKKGRGHV
101-125RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MMERGSDDFTSSNQPIMVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFPEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKINPNQAAAKTTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.31
4 0.36
5 0.34
6 0.36
7 0.44
8 0.52
9 0.56
10 0.62
11 0.66
12 0.69
13 0.74
14 0.75
15 0.73
16 0.74
17 0.79
18 0.76
19 0.75
20 0.73
21 0.73
22 0.79
23 0.81
24 0.77
25 0.69
26 0.68
27 0.65
28 0.66
29 0.65
30 0.62
31 0.59
32 0.61
33 0.64
34 0.66
35 0.68
36 0.67
37 0.69
38 0.7
39 0.72
40 0.68
41 0.69
42 0.64
43 0.64
44 0.56
45 0.48
46 0.42
47 0.34
48 0.32
49 0.25
50 0.22
51 0.13
52 0.12
53 0.1
54 0.09
55 0.08
56 0.07
57 0.07
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.08
64 0.09
65 0.09
66 0.11
67 0.11
68 0.11
69 0.12
70 0.15
71 0.2
72 0.22
73 0.24
74 0.26
75 0.26
76 0.27
77 0.28
78 0.26
79 0.21
80 0.21
81 0.19
82 0.2
83 0.2
84 0.22
85 0.23
86 0.29
87 0.32
88 0.33
89 0.36
90 0.41
91 0.5
92 0.56
93 0.62
94 0.66
95 0.7
96 0.76
97 0.81
98 0.82
99 0.8
100 0.81
101 0.8
102 0.81
103 0.81
104 0.79
105 0.79
106 0.79
107 0.81
108 0.8
109 0.81
110 0.76
111 0.78
112 0.8
113 0.82
114 0.79
115 0.73
116 0.71
117 0.67
118 0.64