Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135LZV0

Protein Details
Accession A0A135LZV0   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-61TLVPRQTKPKTYKKRNIPRNYNGEYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.833, mito_nucl 12.332, cyto 4
Family & Domain DBs
Amino Acid Sequences MPETSRLSRYDHLKAIFSRNSSQEREIKDDATSETTLVPRQTKPKTYKKRNIPRNYNGEYLSPKVMTCNIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.43
4 0.4
5 0.38
6 0.37
7 0.4
8 0.39
9 0.41
10 0.38
11 0.38
12 0.41
13 0.39
14 0.34
15 0.3
16 0.28
17 0.24
18 0.22
19 0.19
20 0.12
21 0.12
22 0.11
23 0.12
24 0.13
25 0.14
26 0.13
27 0.21
28 0.25
29 0.32
30 0.4
31 0.5
32 0.59
33 0.68
34 0.76
35 0.79
36 0.86
37 0.89
38 0.91
39 0.9
40 0.88
41 0.87
42 0.82
43 0.75
44 0.66
45 0.59
46 0.52
47 0.45
48 0.4
49 0.31
50 0.26
51 0.24