Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135LA22

Protein Details
Accession A0A135LA22    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-78GFPAPRQRKPSSFKQRRSNHPTPPAPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013929  RNA_pol_II_AP1_C  
IPR013930  RNA_pol_II_AP1_N  
IPR039913  RPAP1/Rba50  
Gene Ontology GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF08620  RPAP1_C  
PF08621  RPAP1_N  
Amino Acid Sequences MAFRGERFLLDLDEESGTPEIPSPFSLVGEIQERAPSTAIPPAPKLPASSTGFPAPRQRKPSSFKQRRSNHPTPPAPVPTEPTAQDDKKTIDEENRRQLAAMSDAQIQQEREELMEQMDPGLLKRFLRRANIEEDQKTEFSPPAPVADEKSKPRKSVSFNIPPSAPVAATQSAQSHSLSKESPKPHPRNEDLAPPTLPQDLHPASQRPSLDPATLETFHFPQPTKPMPVLDPSSPSFLSDLQSHYFPEIAQDPSTLSWLQPLSADEEDPDSTSAYHPTSNAISMAPSAIRFSLTGTILAPETSLSLPTTMGLHHHGEDPHAAGYTIPELAILARSTFPAQRCIAWQVIGRILFRLGRAEFGDRGGPLSDGLWFVIEKEGIVAGMLAEADGAAGQTQGRNKSKNAKDDEEGGNLPLASGVGRHASAAAWAVEGIWLWQKGGGGDRGLLKEGQHRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.14
5 0.12
6 0.14
7 0.13
8 0.13
9 0.14
10 0.15
11 0.15
12 0.16
13 0.17
14 0.14
15 0.15
16 0.18
17 0.18
18 0.16
19 0.18
20 0.19
21 0.19
22 0.19
23 0.16
24 0.14
25 0.21
26 0.23
27 0.23
28 0.26
29 0.28
30 0.31
31 0.32
32 0.32
33 0.29
34 0.34
35 0.37
36 0.37
37 0.37
38 0.4
39 0.41
40 0.42
41 0.49
42 0.48
43 0.5
44 0.55
45 0.58
46 0.6
47 0.65
48 0.73
49 0.74
50 0.77
51 0.79
52 0.82
53 0.84
54 0.86
55 0.9
56 0.87
57 0.86
58 0.85
59 0.81
60 0.76
61 0.74
62 0.68
63 0.62
64 0.55
65 0.5
66 0.43
67 0.41
68 0.37
69 0.35
70 0.37
71 0.34
72 0.35
73 0.33
74 0.31
75 0.31
76 0.32
77 0.29
78 0.31
79 0.4
80 0.46
81 0.52
82 0.52
83 0.49
84 0.47
85 0.46
86 0.39
87 0.33
88 0.27
89 0.2
90 0.2
91 0.22
92 0.22
93 0.24
94 0.22
95 0.18
96 0.17
97 0.15
98 0.13
99 0.13
100 0.12
101 0.11
102 0.11
103 0.11
104 0.09
105 0.1
106 0.09
107 0.09
108 0.12
109 0.12
110 0.13
111 0.17
112 0.23
113 0.27
114 0.34
115 0.37
116 0.37
117 0.43
118 0.48
119 0.51
120 0.46
121 0.44
122 0.41
123 0.37
124 0.34
125 0.28
126 0.22
127 0.16
128 0.17
129 0.15
130 0.13
131 0.15
132 0.15
133 0.17
134 0.23
135 0.27
136 0.32
137 0.42
138 0.44
139 0.43
140 0.47
141 0.5
142 0.5
143 0.55
144 0.57
145 0.57
146 0.56
147 0.57
148 0.53
149 0.47
150 0.42
151 0.32
152 0.23
153 0.13
154 0.13
155 0.11
156 0.12
157 0.12
158 0.12
159 0.12
160 0.14
161 0.14
162 0.13
163 0.12
164 0.14
165 0.14
166 0.17
167 0.23
168 0.26
169 0.35
170 0.43
171 0.49
172 0.54
173 0.61
174 0.62
175 0.61
176 0.58
177 0.58
178 0.5
179 0.46
180 0.4
181 0.32
182 0.29
183 0.25
184 0.23
185 0.14
186 0.19
187 0.17
188 0.18
189 0.2
190 0.21
191 0.21
192 0.25
193 0.24
194 0.19
195 0.22
196 0.21
197 0.2
198 0.18
199 0.18
200 0.18
201 0.18
202 0.17
203 0.14
204 0.14
205 0.15
206 0.17
207 0.15
208 0.13
209 0.18
210 0.2
211 0.21
212 0.2
213 0.21
214 0.2
215 0.23
216 0.24
217 0.19
218 0.2
219 0.18
220 0.2
221 0.19
222 0.18
223 0.15
224 0.13
225 0.14
226 0.12
227 0.13
228 0.12
229 0.12
230 0.12
231 0.12
232 0.11
233 0.09
234 0.1
235 0.1
236 0.1
237 0.1
238 0.1
239 0.1
240 0.1
241 0.12
242 0.11
243 0.08
244 0.09
245 0.09
246 0.09
247 0.09
248 0.1
249 0.12
250 0.12
251 0.12
252 0.1
253 0.11
254 0.11
255 0.11
256 0.11
257 0.08
258 0.08
259 0.08
260 0.1
261 0.09
262 0.09
263 0.09
264 0.1
265 0.11
266 0.11
267 0.11
268 0.09
269 0.08
270 0.08
271 0.08
272 0.07
273 0.06
274 0.06
275 0.06
276 0.07
277 0.06
278 0.07
279 0.1
280 0.1
281 0.11
282 0.1
283 0.11
284 0.1
285 0.1
286 0.09
287 0.06
288 0.07
289 0.06
290 0.07
291 0.06
292 0.07
293 0.07
294 0.07
295 0.08
296 0.06
297 0.08
298 0.1
299 0.12
300 0.12
301 0.15
302 0.15
303 0.16
304 0.16
305 0.16
306 0.13
307 0.12
308 0.11
309 0.08
310 0.09
311 0.09
312 0.08
313 0.06
314 0.05
315 0.05
316 0.05
317 0.07
318 0.07
319 0.07
320 0.07
321 0.08
322 0.1
323 0.14
324 0.15
325 0.19
326 0.2
327 0.2
328 0.23
329 0.26
330 0.25
331 0.24
332 0.25
333 0.22
334 0.25
335 0.26
336 0.23
337 0.2
338 0.21
339 0.19
340 0.18
341 0.2
342 0.16
343 0.16
344 0.18
345 0.2
346 0.2
347 0.2
348 0.22
349 0.17
350 0.18
351 0.16
352 0.14
353 0.11
354 0.11
355 0.1
356 0.09
357 0.09
358 0.08
359 0.07
360 0.08
361 0.1
362 0.1
363 0.08
364 0.08
365 0.08
366 0.07
367 0.07
368 0.06
369 0.04
370 0.04
371 0.04
372 0.03
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.04
381 0.07
382 0.12
383 0.21
384 0.27
385 0.3
386 0.35
387 0.46
388 0.53
389 0.59
390 0.63
391 0.6
392 0.58
393 0.61
394 0.6
395 0.54
396 0.48
397 0.39
398 0.33
399 0.26
400 0.23
401 0.16
402 0.12
403 0.07
404 0.07
405 0.07
406 0.08
407 0.09
408 0.09
409 0.09
410 0.09
411 0.1
412 0.12
413 0.11
414 0.09
415 0.09
416 0.09
417 0.08
418 0.08
419 0.09
420 0.12
421 0.12
422 0.12
423 0.13
424 0.14
425 0.15
426 0.2
427 0.21
428 0.18
429 0.21
430 0.25
431 0.26
432 0.27
433 0.27
434 0.24
435 0.3