Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135LVV1

Protein Details
Accession A0A135LVV1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-22VNSLWFKWKKLRLPWRKSFLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MVNSLWFKWKKLRLPWRKSFLVGEDLNGNTFWEFKDVMNAARYRRIVRFDPKTHFSDVQVTPQWHQWLRHVRKDPPSIQEQQQDLVRQAQIKQLARLADERWASKASFLDKPKTQHEAPSTQINEATLNQPANAGPSQAPASATTPKAKPEPAYPKTLKEENPWAKANKANPGEEWQPEAWSPSSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.84
4 0.79
5 0.74
6 0.67
7 0.59
8 0.56
9 0.46
10 0.37
11 0.33
12 0.3
13 0.27
14 0.23
15 0.2
16 0.12
17 0.13
18 0.11
19 0.1
20 0.1
21 0.1
22 0.16
23 0.16
24 0.19
25 0.23
26 0.26
27 0.25
28 0.3
29 0.33
30 0.3
31 0.33
32 0.36
33 0.37
34 0.44
35 0.51
36 0.51
37 0.56
38 0.57
39 0.57
40 0.56
41 0.51
42 0.43
43 0.42
44 0.36
45 0.35
46 0.35
47 0.33
48 0.29
49 0.32
50 0.34
51 0.29
52 0.29
53 0.31
54 0.37
55 0.42
56 0.5
57 0.52
58 0.53
59 0.59
60 0.65
61 0.61
62 0.54
63 0.54
64 0.49
65 0.47
66 0.47
67 0.39
68 0.34
69 0.32
70 0.29
71 0.25
72 0.22
73 0.19
74 0.15
75 0.15
76 0.16
77 0.2
78 0.2
79 0.19
80 0.2
81 0.19
82 0.19
83 0.2
84 0.17
85 0.16
86 0.17
87 0.16
88 0.16
89 0.17
90 0.16
91 0.15
92 0.17
93 0.15
94 0.21
95 0.23
96 0.27
97 0.29
98 0.33
99 0.35
100 0.39
101 0.36
102 0.35
103 0.37
104 0.35
105 0.34
106 0.38
107 0.35
108 0.3
109 0.3
110 0.25
111 0.22
112 0.19
113 0.18
114 0.13
115 0.12
116 0.12
117 0.12
118 0.11
119 0.13
120 0.12
121 0.12
122 0.09
123 0.11
124 0.13
125 0.13
126 0.14
127 0.12
128 0.15
129 0.18
130 0.2
131 0.22
132 0.22
133 0.25
134 0.28
135 0.29
136 0.29
137 0.34
138 0.43
139 0.42
140 0.5
141 0.49
142 0.52
143 0.55
144 0.59
145 0.52
146 0.48
147 0.56
148 0.54
149 0.58
150 0.57
151 0.53
152 0.51
153 0.53
154 0.51
155 0.5
156 0.47
157 0.43
158 0.4
159 0.44
160 0.45
161 0.42
162 0.42
163 0.33
164 0.31
165 0.29
166 0.3
167 0.26