Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R4Y4

Protein Details
Accession E5R4Y4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
138-157ATRAALLTRKEKKSKKCLILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007264  P:small GTPase mediated signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
Amino Acid Sequences MLSLVVSSPRVYVPTVFENYVADVEVDGKHVELALWDTAGQEDYDRLRPLSYPESHVILIWFPIDSPESLDKGLPIILVGCKKDLRLDQKTIEELHKTSQKPVTPEQAEDVRKKIGAQKYLECSAKTNEGVREVFEHATRAALLTRKEKKSKKCLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.25
4 0.24
5 0.24
6 0.24
7 0.22
8 0.18
9 0.12
10 0.08
11 0.09
12 0.09
13 0.1
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.06
29 0.07
30 0.1
31 0.13
32 0.14
33 0.14
34 0.14
35 0.15
36 0.19
37 0.24
38 0.23
39 0.23
40 0.24
41 0.26
42 0.26
43 0.25
44 0.22
45 0.15
46 0.14
47 0.09
48 0.07
49 0.05
50 0.05
51 0.06
52 0.05
53 0.08
54 0.1
55 0.1
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.07
62 0.05
63 0.04
64 0.06
65 0.07
66 0.08
67 0.09
68 0.09
69 0.09
70 0.12
71 0.16
72 0.22
73 0.26
74 0.29
75 0.31
76 0.33
77 0.34
78 0.33
79 0.31
80 0.25
81 0.21
82 0.22
83 0.25
84 0.24
85 0.26
86 0.29
87 0.3
88 0.32
89 0.35
90 0.4
91 0.35
92 0.35
93 0.35
94 0.37
95 0.39
96 0.37
97 0.35
98 0.28
99 0.26
100 0.27
101 0.3
102 0.29
103 0.32
104 0.34
105 0.38
106 0.42
107 0.47
108 0.49
109 0.42
110 0.39
111 0.35
112 0.36
113 0.32
114 0.31
115 0.27
116 0.29
117 0.29
118 0.27
119 0.27
120 0.25
121 0.25
122 0.21
123 0.21
124 0.16
125 0.17
126 0.16
127 0.14
128 0.14
129 0.17
130 0.21
131 0.29
132 0.38
133 0.46
134 0.56
135 0.64
136 0.7
137 0.77