Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R4L8

Protein Details
Accession E5R4L8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-93ILNAVPKKKTSYRKKRQRFLAGKGHydrophilic
132-151QWSFRRPTEKQAKQMRREKLHydrophilic
NLS Segment(s)
PositionSequence
76-87KKKTSYRKKRQR
141-168KQAKQMRREKLIEKRRYRGLDPDPRKEK
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALARPLPPLWQTLFPALNAPVRPALQLQLPFLQRLTQPLGALSTPFGALAMPSLSLPAIPSLADVWDGILNAVPKKKTSYRKKRQRFLAGKGLKDVTALNRCSGCGRVKRMHILCPYCVDAIKTSIFGQLQWSFRRPTEKQAKQMRREKLIEKRRYRGLDPDPRKEKEEQIVKHTGWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.29
4 0.28
5 0.29
6 0.25
7 0.25
8 0.22
9 0.21
10 0.22
11 0.2
12 0.2
13 0.2
14 0.21
15 0.22
16 0.24
17 0.25
18 0.25
19 0.24
20 0.25
21 0.2
22 0.23
23 0.25
24 0.21
25 0.2
26 0.2
27 0.21
28 0.18
29 0.18
30 0.15
31 0.1
32 0.08
33 0.08
34 0.07
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.06
55 0.06
56 0.05
57 0.06
58 0.07
59 0.08
60 0.11
61 0.11
62 0.11
63 0.16
64 0.23
65 0.33
66 0.43
67 0.53
68 0.62
69 0.72
70 0.82
71 0.85
72 0.87
73 0.88
74 0.83
75 0.78
76 0.78
77 0.71
78 0.62
79 0.55
80 0.47
81 0.35
82 0.29
83 0.23
84 0.17
85 0.19
86 0.19
87 0.18
88 0.18
89 0.18
90 0.19
91 0.21
92 0.22
93 0.22
94 0.27
95 0.31
96 0.33
97 0.42
98 0.42
99 0.46
100 0.47
101 0.45
102 0.4
103 0.38
104 0.37
105 0.29
106 0.28
107 0.22
108 0.16
109 0.16
110 0.15
111 0.14
112 0.12
113 0.14
114 0.14
115 0.13
116 0.17
117 0.19
118 0.23
119 0.25
120 0.27
121 0.27
122 0.29
123 0.37
124 0.34
125 0.4
126 0.47
127 0.51
128 0.58
129 0.66
130 0.74
131 0.76
132 0.83
133 0.8
134 0.77
135 0.75
136 0.74
137 0.74
138 0.74
139 0.75
140 0.75
141 0.74
142 0.75
143 0.75
144 0.7
145 0.69
146 0.68
147 0.69
148 0.69
149 0.73
150 0.72
151 0.7
152 0.71
153 0.65
154 0.61
155 0.6
156 0.62
157 0.55
158 0.55
159 0.59
160 0.55