Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135LV53

Protein Details
Accession A0A135LV53    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
71-95FKWMHDRDRKKEKEKRDKEKANFGKBasic
142-167NDMARKRQKNYIKRVKKDQRAEDLSRHydrophilic
NLS Segment(s)
PositionSequence
77-95RDRKKEKEKRDKEKANFGK
Subcellular Location(s) cyto 11, cysk 7, nucl 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSTPQADLSEKAAAAAEDFFAQLYVFFETIVTRFFKNGYASIAQMSGKRWTKVIGSVVFYLIIRPYIEKAFKWMHDRDRKKEKEKRDKEKANFGKVKVSPNSLRVGGDSGKGKVLGEVDNTDDELEDEEDVMAAASGVPEWNDMARKRQKNYIKRVKKDQRAEDLSRDQIMELLDWSEDEEVDEKVKKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.1
4 0.08
5 0.08
6 0.07
7 0.07
8 0.07
9 0.06
10 0.07
11 0.08
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.11
18 0.12
19 0.11
20 0.12
21 0.12
22 0.16
23 0.18
24 0.18
25 0.2
26 0.19
27 0.2
28 0.2
29 0.21
30 0.18
31 0.17
32 0.18
33 0.22
34 0.25
35 0.25
36 0.24
37 0.24
38 0.25
39 0.28
40 0.32
41 0.26
42 0.25
43 0.25
44 0.25
45 0.24
46 0.22
47 0.18
48 0.12
49 0.1
50 0.07
51 0.08
52 0.09
53 0.12
54 0.14
55 0.14
56 0.18
57 0.21
58 0.24
59 0.28
60 0.31
61 0.37
62 0.46
63 0.53
64 0.56
65 0.64
66 0.68
67 0.73
68 0.75
69 0.77
70 0.78
71 0.82
72 0.84
73 0.83
74 0.85
75 0.79
76 0.83
77 0.78
78 0.76
79 0.7
80 0.6
81 0.57
82 0.49
83 0.51
84 0.41
85 0.4
86 0.32
87 0.3
88 0.32
89 0.25
90 0.23
91 0.18
92 0.19
93 0.15
94 0.15
95 0.14
96 0.13
97 0.13
98 0.13
99 0.12
100 0.11
101 0.11
102 0.09
103 0.09
104 0.1
105 0.1
106 0.11
107 0.11
108 0.1
109 0.08
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.03
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.06
129 0.11
130 0.12
131 0.22
132 0.31
133 0.38
134 0.41
135 0.5
136 0.59
137 0.64
138 0.74
139 0.76
140 0.77
141 0.79
142 0.87
143 0.88
144 0.88
145 0.88
146 0.86
147 0.85
148 0.82
149 0.79
150 0.76
151 0.71
152 0.64
153 0.55
154 0.47
155 0.36
156 0.3
157 0.26
158 0.19
159 0.13
160 0.11
161 0.09
162 0.09
163 0.1
164 0.09
165 0.08
166 0.09
167 0.09
168 0.09
169 0.13
170 0.16