Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135LXU0

Protein Details
Accession A0A135LXU0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-58TEEFRRIKRKSKPSAGPANAHydrophilic
NLS Segment(s)
PositionSequence
45-50IKRKSK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01717  Sm_B  
Amino Acid Sequences MASHKMQNLINYRMRVTLNDGRQMTGSMLAFDKAFLADTEEFRRIKRKSKPSAGPANAPMVEAEEKRSLGLTIVRGTQVVSCSVEGPPAADPSARLGTAGPGAAATLAAGPGISKPAGRGLPIGLGGPAAGVGGPPPPGGFGFPPGGFPGAPLPGFAGRGGPPGGPPGFAPPPGFAPQGGPPAGFQPPPGFQPPGQGRGYPPPGFGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.37
4 0.38
5 0.37
6 0.43
7 0.42
8 0.39
9 0.39
10 0.38
11 0.3
12 0.26
13 0.21
14 0.14
15 0.14
16 0.14
17 0.13
18 0.12
19 0.12
20 0.08
21 0.08
22 0.07
23 0.11
24 0.12
25 0.15
26 0.2
27 0.24
28 0.24
29 0.25
30 0.34
31 0.32
32 0.39
33 0.47
34 0.53
35 0.59
36 0.68
37 0.76
38 0.76
39 0.84
40 0.78
41 0.73
42 0.64
43 0.59
44 0.49
45 0.4
46 0.31
47 0.23
48 0.22
49 0.17
50 0.18
51 0.15
52 0.15
53 0.15
54 0.15
55 0.12
56 0.11
57 0.13
58 0.12
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.12
65 0.11
66 0.1
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.1
80 0.11
81 0.1
82 0.09
83 0.08
84 0.09
85 0.09
86 0.09
87 0.06
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.04
100 0.04
101 0.04
102 0.04
103 0.08
104 0.09
105 0.09
106 0.1
107 0.09
108 0.1
109 0.11
110 0.1
111 0.07
112 0.06
113 0.06
114 0.05
115 0.04
116 0.03
117 0.02
118 0.02
119 0.02
120 0.03
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.07
127 0.07
128 0.09
129 0.12
130 0.12
131 0.13
132 0.13
133 0.14
134 0.13
135 0.13
136 0.12
137 0.11
138 0.11
139 0.1
140 0.11
141 0.11
142 0.12
143 0.12
144 0.12
145 0.1
146 0.12
147 0.13
148 0.12
149 0.11
150 0.15
151 0.15
152 0.14
153 0.14
154 0.18
155 0.19
156 0.21
157 0.22
158 0.18
159 0.22
160 0.25
161 0.25
162 0.19
163 0.2
164 0.22
165 0.26
166 0.25
167 0.21
168 0.19
169 0.21
170 0.24
171 0.21
172 0.19
173 0.18
174 0.2
175 0.24
176 0.28
177 0.28
178 0.25
179 0.36
180 0.4
181 0.42
182 0.41
183 0.39
184 0.38
185 0.45
186 0.52
187 0.43
188 0.38