Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HHV3

Protein Details
Accession A0A139HHV3   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-53ADPESQSRKSHRKKALRPQQVIGRSKPRKREGRNTHQPPGHydrophilic
NLS Segment(s)
PositionSequence
21-46RKSHRKKALRPQQVIGRSKPRKREGR
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MPTRKESPVRESSADPESQSRKSHRKKALRPQQVIGRSKPRKREGRNTHQPPGIDSPTRQYRQSKLQTSTPHPKLRARSQNLIASSSDNVANLSVHPTYTAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.35
3 0.34
4 0.33
5 0.33
6 0.36
7 0.4
8 0.47
9 0.55
10 0.63
11 0.67
12 0.73
13 0.79
14 0.85
15 0.88
16 0.88
17 0.83
18 0.78
19 0.76
20 0.74
21 0.68
22 0.62
23 0.62
24 0.61
25 0.62
26 0.66
27 0.66
28 0.68
29 0.71
30 0.76
31 0.76
32 0.78
33 0.84
34 0.82
35 0.78
36 0.71
37 0.63
38 0.55
39 0.5
40 0.42
41 0.31
42 0.25
43 0.26
44 0.31
45 0.33
46 0.33
47 0.31
48 0.32
49 0.41
50 0.49
51 0.5
52 0.46
53 0.5
54 0.53
55 0.58
56 0.64
57 0.62
58 0.6
59 0.57
60 0.58
61 0.59
62 0.64
63 0.66
64 0.63
65 0.63
66 0.62
67 0.65
68 0.61
69 0.56
70 0.46
71 0.38
72 0.32
73 0.26
74 0.2
75 0.14
76 0.13
77 0.12
78 0.11
79 0.1
80 0.13
81 0.11
82 0.11
83 0.11