Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139GWR4

Protein Details
Accession A0A139GWR4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-28LSTCSRQYRGPRTNSNNKPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MSAINTKRLSTCSRQYRGPRTNSNNKPSTPALDLAITSNYKGVARGGLEVALSPTLTPSTPVLDLATTSNYKGVARGGLEVALPLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.71
4 0.74
5 0.74
6 0.74
7 0.73
8 0.8
9 0.8
10 0.8
11 0.74
12 0.66
13 0.63
14 0.55
15 0.49
16 0.41
17 0.33
18 0.26
19 0.21
20 0.2
21 0.16
22 0.17
23 0.13
24 0.1
25 0.09
26 0.09
27 0.08
28 0.08
29 0.07
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.05
39 0.05
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.07
46 0.09
47 0.09
48 0.1
49 0.1
50 0.1
51 0.11
52 0.11
53 0.14
54 0.12
55 0.12
56 0.13
57 0.13
58 0.13
59 0.13
60 0.13
61 0.11
62 0.11
63 0.11
64 0.1
65 0.1
66 0.09