Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HIQ9

Protein Details
Accession A0A139HIQ9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-35RLETRRLEQKYARRDKRRTSVPNIQYHydrophilic
NLS Segment(s)
PositionSequence
58-70KARRRSLAPRPRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MGLIDKIRSRLETRRLEQKYARRDKRRTSVPNIQYVDGEYVLSDLSSTGRDLNPAANKARRRSLAPRPRRGSLPYGRDGITPDCPQESAPRPKARNRESVVLRYMAEPEEEAYTYRRQSYRPPPRTRDSVVLRNMDYLPGEETRSRRQPRNRESIVLGNMLVEDPPPKRTQPPPRNRDSIVMRGMAEWTDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.66
4 0.69
5 0.7
6 0.71
7 0.72
8 0.78
9 0.77
10 0.81
11 0.84
12 0.86
13 0.88
14 0.85
15 0.83
16 0.83
17 0.79
18 0.8
19 0.73
20 0.63
21 0.53
22 0.46
23 0.39
24 0.28
25 0.22
26 0.12
27 0.1
28 0.09
29 0.08
30 0.06
31 0.04
32 0.04
33 0.05
34 0.06
35 0.08
36 0.08
37 0.09
38 0.1
39 0.15
40 0.18
41 0.21
42 0.26
43 0.3
44 0.35
45 0.38
46 0.44
47 0.41
48 0.43
49 0.48
50 0.54
51 0.58
52 0.63
53 0.7
54 0.68
55 0.68
56 0.66
57 0.62
58 0.59
59 0.56
60 0.52
61 0.44
62 0.42
63 0.39
64 0.36
65 0.35
66 0.29
67 0.25
68 0.2
69 0.18
70 0.16
71 0.15
72 0.15
73 0.19
74 0.23
75 0.28
76 0.34
77 0.4
78 0.43
79 0.48
80 0.57
81 0.57
82 0.58
83 0.53
84 0.54
85 0.5
86 0.51
87 0.47
88 0.38
89 0.34
90 0.26
91 0.24
92 0.16
93 0.13
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.09
100 0.11
101 0.12
102 0.16
103 0.16
104 0.17
105 0.25
106 0.36
107 0.45
108 0.53
109 0.61
110 0.64
111 0.68
112 0.73
113 0.68
114 0.66
115 0.61
116 0.59
117 0.56
118 0.52
119 0.47
120 0.43
121 0.4
122 0.32
123 0.25
124 0.18
125 0.15
126 0.13
127 0.15
128 0.15
129 0.19
130 0.26
131 0.35
132 0.41
133 0.47
134 0.56
135 0.65
136 0.71
137 0.78
138 0.74
139 0.68
140 0.66
141 0.64
142 0.57
143 0.48
144 0.38
145 0.28
146 0.24
147 0.2
148 0.16
149 0.09
150 0.1
151 0.1
152 0.14
153 0.17
154 0.19
155 0.25
156 0.35
157 0.46
158 0.54
159 0.64
160 0.69
161 0.74
162 0.79
163 0.75
164 0.74
165 0.69
166 0.66
167 0.59
168 0.53
169 0.45
170 0.39
171 0.37