FuNGI

A0A139HP88

Protein Details

Accession

A0A139HP88

Localization Confidence

Low

Confidence Score

7.3

NoLS Segment(s)

Position	Sequence	Protein Nature
48-68	TKDANRRQDKNYKNDVPRQLF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 9.5, cyto_nucl 9, nucl 7.5, extr 7

Family & Domain DBs

Amino Acid Sequences

MAAPIDQQLFTDAQLNPGTSLAAGPRLILQNGTFTFFCKTMGQPKSVTKDANRRQDKNYKNDVPRQLFATLTKPLFDLASKATPGFPQLPKLAIMHVCNKTNAELLSLLGLAITFIPKKEYDVNKDGIAAVITAPQLSPIPLHAQYTTGFPKSRNALQRRHGGDQFLDAVDDYLWYNPQQSPLAQYFPGQQPQGQQQPPPPPAPIQATVAAPNPPANAAVAQVNQSGPAAIAHPASQQVPQPSVVQATAINVAAPNLPANVGVSQVSQPAPAAVTYPAQQVQLPQAVAGQASAFPFAAPNAQASFGAPQLYQPGPAATTYSAPSMPLQQPGWNQAASSNSVAPNAPVNYGAGQPGHAAMMYPAQQMPAPPAHIDPRLLQCVNAGQGAPLISQAFPPFTHQGVDEVDELPVQPDQGAPGVEQDNQDPVEETEAFGWDDLLIPDAYAEVDEMNPQPQNDAPKSDEAGPWDQFWDEYQEFINPDADQVNAGSS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.22
3	0.2
4	0.2
5	0.19
6	0.13
7	0.14
8	0.11
9	0.13
10	0.12
11	0.12
12	0.16
13	0.18
14	0.19
15	0.19
16	0.18
17	0.21
18	0.22
19	0.26
20	0.22
21	0.21
22	0.23
23	0.22
24	0.24
25	0.2
26	0.23
27	0.29
28	0.34
29	0.36
30	0.37
31	0.44
32	0.49
33	0.51
34	0.52
35	0.5
36	0.57
37	0.63
38	0.69
39	0.71
40	0.69
41	0.73
42	0.78
43	0.78
44	0.77
45	0.79
46	0.78
47	0.76
48	0.81
49	0.82
50	0.78
51	0.72
52	0.65
53	0.56
54	0.48
55	0.42
56	0.37
57	0.33
58	0.28
59	0.26
60	0.23
61	0.22
62	0.21
63	0.19
64	0.17
65	0.15
66	0.19
67	0.19
68	0.19
69	0.2
70	0.19
71	0.23
72	0.27
73	0.24
74	0.25
75	0.26
76	0.27
77	0.27
78	0.27
79	0.27
80	0.24
81	0.26
82	0.3
83	0.33
84	0.33
85	0.33
86	0.33
87	0.31
88	0.3
89	0.27
90	0.2
91	0.15
92	0.14
93	0.13
94	0.12
95	0.1
96	0.07
97	0.07
98	0.05
99	0.05
100	0.06
101	0.06
102	0.06
103	0.09
104	0.09
105	0.12
106	0.21
107	0.27
108	0.33
109	0.38
110	0.4
111	0.38
112	0.39
113	0.36
114	0.28
115	0.21
116	0.14
117	0.09
118	0.08
119	0.08
120	0.07
121	0.07
122	0.07
123	0.07
124	0.07
125	0.07
126	0.07
127	0.11
128	0.12
129	0.14
130	0.13
131	0.15
132	0.15
133	0.19
134	0.21
135	0.2
136	0.21
137	0.2
138	0.25
139	0.28
140	0.34
141	0.39
142	0.42
143	0.47
144	0.52
145	0.6
146	0.6
147	0.62
148	0.56
149	0.49
150	0.43
151	0.37
152	0.32
153	0.23
154	0.18
155	0.12
156	0.11
157	0.09
158	0.09
159	0.07
160	0.05
161	0.06
162	0.06
163	0.09
164	0.09
165	0.12
166	0.12
167	0.12
168	0.16
169	0.18
170	0.2
171	0.18
172	0.18
173	0.2
174	0.22
175	0.25
176	0.21
177	0.2
178	0.21
179	0.27
180	0.34
181	0.31
182	0.3
183	0.32
184	0.39
185	0.41
186	0.4
187	0.35
188	0.28
189	0.3
190	0.32
191	0.28
192	0.22
193	0.21
194	0.2
195	0.2
196	0.2
197	0.18
198	0.14
199	0.13
200	0.11
201	0.09
202	0.09
203	0.08
204	0.06
205	0.06
206	0.08
207	0.08
208	0.08
209	0.09
210	0.08
211	0.08
212	0.08
213	0.07
214	0.06
215	0.05
216	0.05
217	0.05
218	0.06
219	0.06
220	0.06
221	0.07
222	0.08
223	0.09
224	0.1
225	0.11
226	0.12
227	0.13
228	0.13
229	0.12
230	0.12
231	0.11
232	0.09
233	0.08
234	0.08
235	0.08
236	0.07
237	0.06
238	0.05
239	0.06
240	0.06
241	0.06
242	0.05
243	0.04
244	0.04
245	0.04
246	0.05
247	0.05
248	0.05
249	0.05
250	0.06
251	0.06
252	0.08
253	0.08
254	0.07
255	0.07
256	0.07
257	0.07
258	0.06
259	0.07
260	0.06
261	0.07
262	0.08
263	0.09
264	0.1
265	0.1
266	0.1
267	0.1
268	0.12
269	0.14
270	0.12
271	0.11
272	0.1
273	0.1
274	0.1
275	0.09
276	0.06
277	0.05
278	0.05
279	0.06
280	0.05
281	0.05
282	0.05
283	0.05
284	0.07
285	0.06
286	0.07
287	0.07
288	0.08
289	0.08
290	0.08
291	0.09
292	0.09
293	0.1
294	0.08
295	0.08
296	0.11
297	0.12
298	0.12
299	0.11
300	0.11
301	0.1
302	0.1
303	0.11
304	0.08
305	0.09
306	0.1
307	0.11
308	0.1
309	0.1
310	0.11
311	0.15
312	0.16
313	0.18
314	0.18
315	0.2
316	0.22
317	0.25
318	0.27
319	0.21
320	0.2
321	0.18
322	0.19
323	0.18
324	0.18
325	0.16
326	0.14
327	0.15
328	0.15
329	0.14
330	0.16
331	0.14
332	0.13
333	0.11
334	0.12
335	0.12
336	0.13
337	0.13
338	0.09
339	0.09
340	0.09
341	0.09
342	0.08
343	0.07
344	0.06
345	0.05
346	0.08
347	0.09
348	0.1
349	0.1
350	0.11
351	0.11
352	0.11
353	0.14
354	0.14
355	0.14
356	0.14
357	0.16
358	0.19
359	0.21
360	0.22
361	0.23
362	0.26
363	0.31
364	0.3
365	0.27
366	0.25
367	0.26
368	0.25
369	0.22
370	0.17
371	0.11
372	0.12
373	0.13
374	0.11
375	0.1
376	0.09
377	0.08
378	0.1
379	0.11
380	0.11
381	0.11
382	0.16
383	0.17
384	0.17
385	0.18
386	0.17
387	0.19
388	0.19
389	0.21
390	0.17
391	0.15
392	0.14
393	0.13
394	0.13
395	0.11
396	0.1
397	0.08
398	0.07
399	0.06
400	0.07
401	0.09
402	0.1
403	0.09
404	0.12
405	0.14
406	0.16
407	0.17
408	0.17
409	0.18
410	0.18
411	0.19
412	0.16
413	0.15
414	0.17
415	0.16
416	0.16
417	0.13
418	0.14
419	0.14
420	0.12
421	0.12
422	0.08
423	0.09
424	0.08
425	0.09
426	0.08
427	0.07
428	0.07
429	0.07
430	0.07
431	0.06
432	0.06
433	0.05
434	0.05
435	0.08
436	0.09
437	0.13
438	0.14
439	0.14
440	0.16
441	0.18
442	0.27
443	0.27
444	0.31
445	0.31
446	0.34
447	0.37
448	0.38
449	0.38
450	0.34
451	0.38
452	0.34
453	0.32
454	0.29
455	0.27
456	0.23
457	0.23
458	0.26
459	0.2
460	0.19
461	0.19
462	0.21
463	0.22
464	0.23
465	0.24
466	0.15
467	0.17
468	0.16
469	0.15
470	0.13

A0A139HP88

3D AlphaFold-predicted Structure Viewer