Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B5RUQ0

Protein Details
Accession B5RUQ0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-28YPKSTFKKVLNSKTKYKFKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.499, cyto_nucl 10.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
KEGG dha:DEHA2G10538g  -  
Amino Acid Sequences MVSTNKASYPKSTFKKVLNSKTKYKFKNDESDLLIYLLYVDYVNKLMNKGRDIQERAGSAEISTNHLELANNELSKHYRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.63
3 0.67
4 0.7
5 0.71
6 0.7
7 0.72
8 0.77
9 0.81
10 0.75
11 0.74
12 0.73
13 0.68
14 0.72
15 0.66
16 0.61
17 0.55
18 0.51
19 0.43
20 0.34
21 0.28
22 0.18
23 0.14
24 0.09
25 0.06
26 0.04
27 0.03
28 0.04
29 0.04
30 0.05
31 0.06
32 0.07
33 0.1
34 0.13
35 0.15
36 0.19
37 0.24
38 0.3
39 0.34
40 0.36
41 0.37
42 0.36
43 0.36
44 0.32
45 0.27
46 0.19
47 0.19
48 0.17
49 0.17
50 0.16
51 0.15
52 0.14
53 0.15
54 0.15
55 0.12
56 0.17
57 0.18
58 0.18
59 0.18
60 0.21