Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HRD9

Protein Details
Accession A0A139HRD9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-76EEQEQKEKERREQREKERREQRMKKHGKKNBasic
NLS Segment(s)
PositionSequence
48-76EQEQKEKERREQREKERREQRMKKHGKKN
Subcellular Location(s) nucl 18.5, cyto_nucl 11.833, cyto 4, cyto_pero 3.333, mito 2
Family & Domain DBs
Amino Acid Sequences MSDDSGYWNHMGDYSDSKGDYDPRSGWTDEDWAESARFAEAARKEREEQEQKEKERREQREKERREQRMKKHGKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.19
5 0.19
6 0.23
7 0.22
8 0.21
9 0.19
10 0.21
11 0.24
12 0.24
13 0.23
14 0.2
15 0.21
16 0.18
17 0.18
18 0.16
19 0.13
20 0.13
21 0.12
22 0.11
23 0.08
24 0.08
25 0.06
26 0.1
27 0.13
28 0.18
29 0.21
30 0.23
31 0.25
32 0.28
33 0.37
34 0.41
35 0.42
36 0.47
37 0.53
38 0.56
39 0.62
40 0.63
41 0.63
42 0.65
43 0.7
44 0.7
45 0.72
46 0.78
47 0.8
48 0.84
49 0.86
50 0.86
51 0.87
52 0.88
53 0.87
54 0.87
55 0.87
56 0.91