Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139H446

Protein Details
Accession A0A139H446    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPRRASKTKKRAADKFAPWHHydrophilic
NLS Segment(s)
PositionSequence
7-12SKTKKR
Subcellular Location(s) mito 10, plas 7, extr 4, E.R. 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPRRASKTKKRAADKFAPWHWVAIGFGIPVIVGLLFYIFASLPISFRFWQSYEATPHAPKNTPASGARLLTTYEYQNVDGQLVPIEVTVPDPFHEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.79
4 0.74
5 0.7
6 0.6
7 0.52
8 0.44
9 0.35
10 0.26
11 0.18
12 0.14
13 0.08
14 0.08
15 0.06
16 0.06
17 0.04
18 0.04
19 0.03
20 0.02
21 0.02
22 0.02
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.05
29 0.05
30 0.05
31 0.06
32 0.09
33 0.09
34 0.1
35 0.11
36 0.11
37 0.14
38 0.16
39 0.19
40 0.19
41 0.21
42 0.23
43 0.23
44 0.25
45 0.25
46 0.24
47 0.22
48 0.24
49 0.23
50 0.24
51 0.24
52 0.26
53 0.26
54 0.25
55 0.24
56 0.2
57 0.19
58 0.18
59 0.19
60 0.15
61 0.15
62 0.16
63 0.17
64 0.18
65 0.18
66 0.16
67 0.15
68 0.14
69 0.12
70 0.1
71 0.09
72 0.07
73 0.07
74 0.07
75 0.08
76 0.09
77 0.09