Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HHM1

Protein Details
Accession A0A139HHM1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
76-105GENDIKSPPRSPRKARNGKKSGKKKLRRAKBasic
NLS Segment(s)
PositionSequence
82-105SPPRSPRKARNGKKSGKKKLRRAK
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTRHKTLVRGTPTSAWPNELREQHRLFSKATPSQGAVTAMRPNDTHSEAMIESLQKATGGKPGMPVDELPLPNTIGENDIKSPPRSPRKARNGKKSGKKKLRRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.34
4 0.36
5 0.39
6 0.41
7 0.4
8 0.42
9 0.43
10 0.43
11 0.46
12 0.43
13 0.39
14 0.36
15 0.39
16 0.36
17 0.36
18 0.34
19 0.3
20 0.29
21 0.29
22 0.26
23 0.2
24 0.17
25 0.18
26 0.16
27 0.16
28 0.15
29 0.16
30 0.17
31 0.18
32 0.16
33 0.13
34 0.15
35 0.13
36 0.14
37 0.12
38 0.09
39 0.07
40 0.07
41 0.07
42 0.05
43 0.06
44 0.05
45 0.09
46 0.1
47 0.1
48 0.13
49 0.14
50 0.14
51 0.15
52 0.14
53 0.13
54 0.17
55 0.17
56 0.15
57 0.15
58 0.15
59 0.14
60 0.15
61 0.12
62 0.09
63 0.1
64 0.11
65 0.12
66 0.16
67 0.2
68 0.21
69 0.26
70 0.33
71 0.43
72 0.5
73 0.56
74 0.63
75 0.71
76 0.81
77 0.86
78 0.88
79 0.88
80 0.9
81 0.92
82 0.92
83 0.92
84 0.92
85 0.92