Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139H3Z2

Protein Details
Accession A0A139H3Z2   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-121RDEKRWRKMKYWPKDFEKRKQEVBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039294  EIF1AD  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01176  eIF-1a  
Amino Acid Sequences MPKPKRNIQAVAEETLTPPDDLPQGQKIARVKSAAGNNLYNLELPGDHEGEAFSTILAELPAKFRSTIWIKRGNFVVVDATALADRGNKLGGEIVNIVRDEKRWRKMKYWPKDFEKRKQEVYGGESDEEEDEGPKMPTDDEDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.27
4 0.17
5 0.14
6 0.13
7 0.13
8 0.14
9 0.17
10 0.18
11 0.2
12 0.2
13 0.25
14 0.28
15 0.3
16 0.32
17 0.3
18 0.27
19 0.3
20 0.35
21 0.35
22 0.34
23 0.31
24 0.28
25 0.29
26 0.28
27 0.21
28 0.16
29 0.12
30 0.08
31 0.09
32 0.1
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.1
39 0.08
40 0.05
41 0.05
42 0.04
43 0.05
44 0.05
45 0.05
46 0.04
47 0.06
48 0.08
49 0.08
50 0.09
51 0.08
52 0.14
53 0.2
54 0.26
55 0.29
56 0.37
57 0.37
58 0.39
59 0.4
60 0.35
61 0.29
62 0.23
63 0.19
64 0.1
65 0.09
66 0.07
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.05
76 0.05
77 0.08
78 0.08
79 0.08
80 0.1
81 0.1
82 0.11
83 0.12
84 0.13
85 0.11
86 0.13
87 0.2
88 0.26
89 0.35
90 0.42
91 0.46
92 0.51
93 0.61
94 0.69
95 0.72
96 0.75
97 0.75
98 0.75
99 0.82
100 0.85
101 0.84
102 0.84
103 0.79
104 0.74
105 0.69
106 0.64
107 0.57
108 0.54
109 0.49
110 0.42
111 0.36
112 0.31
113 0.27
114 0.24
115 0.21
116 0.16
117 0.11
118 0.09
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.12