Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139GT55

Protein Details
Accession A0A139GT55    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-63NTTTGKKKDKTRATRVKTTVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 16.5, nucl 13, cyto 10
Family & Domain DBs
Amino Acid Sequences MQQFDDFIQDQSNRIDEIVNEVYATTTIVLLDGYGGFYILTTVNTTTGKKKDKTRATRVKTTVTTARIALIKVKLRGSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.12
4 0.18
5 0.18
6 0.16
7 0.14
8 0.14
9 0.13
10 0.13
11 0.13
12 0.06
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.06
31 0.08
32 0.09
33 0.13
34 0.2
35 0.26
36 0.3
37 0.38
38 0.47
39 0.56
40 0.65
41 0.71
42 0.76
43 0.77
44 0.82
45 0.77
46 0.75
47 0.66
48 0.62
49 0.58
50 0.5
51 0.44
52 0.35
53 0.35
54 0.29
55 0.27
56 0.26
57 0.27
58 0.3
59 0.32
60 0.35